bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0272_orf2 Length=265 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_6G08900 87.4 4e-16 > 5085.AFUA_6G08900 Length=795 Score = 87.4 bits (215), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 65/193 (33%), Positives = 98/193 (50%), Gaps = 25/193 (12%) Query 4 SPELQEGLQRLGIRKLADVQRHCLLRALAGTSLIVAARPGAGKTLAYLIPILQRFMAEEM 63 SPE+ GL ++ VQ C+ + L G +I A G+GKTLA+ IPIL+ ++ E+ Sbjct 209 SPEILTGLSKMKFGSPTSVQEACIPQILEGHDVIGKASTGSGKTLAFGIPILEHYL-EKK 267 Query 64 RDTLNTS----AEAHSFPFALILVPSRELARQVTSVAMALLPQAP-----VILLDPTSPM 114 RD ++ +E S P ALIL P+RELA Q++ L+ QAP + LL + Sbjct 268 RDDISAQKEQMSEKDSTPIALILSPTRELAHQLSKHIGELIAQAPGVNARIALLTGGLSV 327 Query 115 RQHKELLQHIPAKIVVSTPDRVCALTGFRRPRGMGTTRSGPLEPNPLSLNNLRVLVVDEA 174 ++ + LL A IV+ TP RV + G G R + ++ LVVDEA Sbjct 328 QKQQRLLS--GADIVIGTPGRVWEIL----STGQGLIR---------KMQQIKFLVVDEA 372 Query 175 DALLRRDYHSKIQ 187 D LL + +++ Sbjct 373 DRLLSEGHFKEVE 385 Lambda K H 0.321 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 83755957455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40