bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0262_orf1 Length=238 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00029544001 73.9 4e-12 > 99883.GSTENP00029544001 Length=505 Score = 73.9 bits (180), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 60/150 (40%), Positives = 74/150 (49%), Gaps = 27/150 (18%) Query 68 AEEEDDDDDEAAAEDDSAAEDDSAAEDESAAEDESAAEDESAAEDESAADSSSSEDEDTE 127 E + +DDE D A +S E SA S A SA ++E+ D E EDTE Sbjct 181 TESQLKEDDE-----DYAMNSESYLEKLSAL-SASLARVVSAEDEEAEVDQFPIEGEDTE 234 Query 128 E-EAEEEAAEDKAEEAAKETESEVEICEPHPVQNLFKGLVFFLCRETPLLPLCFAIRSCG 186 + EA+E+ E K EA K+ LF+GL FFL RETP L F IR G Sbjct 235 KMEAQEK--EQKQLEAQKK---------------LFEGLKFFLNRETPRESLAFVIRCFG 277 Query 187 GAVGWQSE---GSPFELGDNRITHQVVDRP 213 G V W GS +E+ D ITHQ+VDRP Sbjct 278 GQVSWDKSICIGSTYEMTDETITHQIVDRP 307 Lambda K H 0.296 0.115 0.298 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 69258123258 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40