bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0220_orf3 Length=236 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_290 93.6 5e-18 > 5807.cgd1_290 Length=499 Score = 93.6 bits (231), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 56/148 (37%), Positives = 71/148 (47%), Gaps = 36/148 (24%) Query 59 GSGAAHSASAPAAEAAEAEAKKKETELLRLAGKPCPTGTYQLLSVVTHQGRYADSGHYVG 118 G + + A E + E +K ETEL CPTG Y+L VVTHQGR ADSGHYV Sbjct 383 GRDISEKKKSKAIEKPDQEEQKMETELY----TDCPTGVYELECVVTHQGRTADSGHYVA 438 Query 119 WARAGDAGTLQGPPTAQSEDKEEEEPAAPSGPAAKRRKNVDMWRKFDDDKVSEVPWDSID 178 W + D+E KFDDDKVS + D Sbjct 439 WRYCPN-------------DRE-------------------YIIKFDDDKVSRIKAKDAD 466 Query 179 LAGGRSDYHVAYLLLMKHILVVPTEEEL 206 L+GGRSDYH+A +LL K ++ +EEE+ Sbjct 467 LSGGRSDYHIAVMLLYKKTVIKASEEEM 494 Lambda K H 0.310 0.125 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 68043068464 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40