bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0114_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000074339 78.6 8e-14 > 7955.ENSDARP00000074339 Length=524 Score = 78.6 bits (192), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 36/86 (41%), Positives = 54/86 (62%), Gaps = 0/86 (0%) Query 62 VMTSNLVLRGMFNPSAADDEYYFEDIRDDVREECGKHGSVVQVSLSEKDEEGRVFVKFTA 121 + T L MFNP++ +D + +I+DDV EEC KHG V+ + + +K EG V+VK Sbjct 415 IATHCFQLSNMFNPNSENDHGWEIEIQDDVIEECNKHGGVIHIYVDKKSAEGNVYVKCPT 474 Query 122 PSVALAAQNALNGRFFGGRQIHAEFA 147 A+AA +AL+GR+FGG+ I A + Sbjct 475 IPAAMAAVSALHGRWFGGKMITAAYV 500 Lambda K H 0.310 0.123 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40