bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0112_orf2 Length=221 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_4830 204 2e-51 > 5807.cgd6_4830 Length=573 Score = 204 bits (518), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 106/215 (49%), Positives = 147/215 (68%), Gaps = 12/215 (5%) Query 4 KMTPTGPVGGLRGSKGLVLLPTRELAMQCYQLLQDLCKFAP-ITSTLAVGGVTLSQQETA 62 +++ G VGG G+K LVLLP+RELAMQC+ +L+ L K+ P IT + GG+ + QQE Sbjct 102 RVSSLGRVGGAVGTKVLVLLPSRELAMQCFGVLESLTKYCPVITRAVVTGGMNIQQQERI 161 Query 63 LRMQPDIVVATPGRIIDLLLNSISIHLELLEVVVLDEADRLLELGFRDQILQVLRHCHRG 122 L+ QP IV+ATPGRI+D+LLN++SI LELLE+++LDEADRLL++GFR + L++L++ R Sbjct 162 LKCQPHIVIATPGRILDMLLNTLSIQLELLEIIILDEADRLLDMGFRQECLEILKYSSRT 221 Query 123 RQTMLFSATLSASISSLALLALQSPLHITCEPRGSSSSSGINSSKKPQQQ-------LPE 175 RQTMLFSATLS S++ LALLAL +P C+ SGI S + L Sbjct 222 RQTMLFSATLSRSVTDLALLALNNP----CKVSTVGLKSGIKSVGSSGESELLSITGLSS 277 Query 176 NLQQQFVELQGEEQRLPALVHLVRTAFKHRVIVFF 210 L+Q+F+E+ EE+R AL +++ F RVIVFF Sbjct 278 TLEQEFLEITKEEEREGALFYILNKIFTKRVIVFF 312 Lambda K H 0.322 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 59781045954 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40