bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0106_orf2 Length=271 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP009808-PA 74.3 4e-12 > 7165.AGAP009808-PA Length=510 Score = 74.3 bits (181), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 16/115 (13%) Query 148 ASDASCSSSSAPEAQGVEQQQEQQQQDGAAAGG-EAAATFASLGLCREMCAAAAAAKWER 206 A++ SS G + +EQ DG A G + + ++ LGL +C A KW+ Sbjct 22 AANGDDSSDQEENGSGTDVDEEQ---DGQAENGTDVSKSWEDLGLIDTLCTACRGLKWKA 78 Query 207 PTAVQQQVIPLALQQLQRLRGVRTVEQRDVIAVAATGSGKTXAFVLPLLQHLLQH 261 P+ +Q++ IPLALQ +D+I +A TGSGKT AF LP+LQ LL + Sbjct 79 PSKIQREAIPLALQ------------GKDIIGLAETGSGKTGAFALPILQALLDN 121 Lambda K H 0.310 0.114 0.302 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 87371322525 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40