bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0020_orf15 Length=432 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_1330 93.6 1e-17 > 5807.cgd5_1330 Length=253 Score = 93.6 bits (231), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 49/103 (47%), Positives = 67/103 (65%), Gaps = 3/103 (2%) Query 124 TLYISNLPLRCGALELRRIFEEVGEVKDCRIVNNPVSRESRGFAFLSFVDPSHAAVAIEH 183 TLY+ L L+ +LRR+FE+ GEV DC +V NP+S ESR F F++ + AA A + Sbjct 72 TLYVCRLSLKTKEDDLRRLFEDYGEVTDCHLVTNPLSGESRCFGFVTMGNEEEAARAKDA 131 Query 184 FDNKTIFGDGSRPVRVERAKRNKPHNPTPGFYKGPPGASIKYD 226 D K + D S ++VE A+R KP++PTPG YKGP SIKY+ Sbjct 132 LDGKE-YQDAS--LKVETARRAKPYDPTPGEYKGPQYRSIKYN 171 Lambda K H 0.316 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 177633483965 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40