bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3332_orf1 Length=93 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070530 ubiquitin fusion degradation domain-containi... 97.8 7e-21 cpv:cgd4_1200 ubiquitin fusion degradation protein (UFD1); dou... 88.2 7e-18 pfa:PF14_0178 UFD1; Ubiquitin fusion degradation protein UFD1,... 84.0 1e-16 tpv:TP02_0530 hypothetical protein; K14016 ubiquitin fusion de... 72.8 3e-13 ath:AT2G21270 ubiquitin fusion degradation UFD1 family protein... 72.8 3e-13 ath:AT4G38930 ubiquitin fusion degradation UFD1 family protein 70.1 2e-12 bbo:BBOV_II005920 18.m06490; ubiquitin fusion degradation prot... 68.2 7e-12 dre:436724 ufd1l, wu:fc55f04, zgc:92341; ubiquitin fusion degr... 63.2 2e-10 xla:399034 ufd1l, MGC68571, ufd1; ubiquitin fusion degradation... 63.2 2e-10 mmu:22230 Ufd1l, Ufd1; ubiquitin fusion degradation 1 like; K1... 61.6 5e-10 hsa:7353 UFD1L, UFD1; ubiquitin fusion degradation 1 like (yea... 61.2 9e-10 sce:YGR048W UFD1; Protein that interacts with Cdc48p and Npl4p... 44.3 1e-04 ath:AT2G29070 ubiquitin fusion degradation UFD1 family protein 43.5 2e-04 cel:F19B6.2 ufd-1; Ubiquitin Fusion Degradation (yeast UFD hom... 42.4 4e-04 ath:AT2G47390 serine-type endopeptidase/ serine-type peptidase 33.9 0.13 mmu:52846 D1Bwg0212e, 2410015L18Rik, C40; DNA segment, Chr 1, ... 29.3 3.4 hsa:55571 C2orf29; chromosome 2 open reading frame 29 29.3 > tgo:TGME49_070530 ubiquitin fusion degradation domain-containing protein (EC:3.1.3.48); K14016 ubiquitin fusion degradation protein 1 Length=335 Score = 97.8 bits (242), Expect = 7e-21, Method: Composition-based stats. Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 3/78 (3%) Query 18 LGRSMASFWGGGGEDGG---GFSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHI 74 R +A+ G G DGG GFS Y+ +PVSF KD +E GNKILLP SALHALARLHI Sbjct 2 FSRHVANLLGMGEMDGGPGSGFSQCYSCFPVSFIGKDEMEKGNKILLPQSALHALARLHI 61 Query 75 SWPMHFRICNPAKDKLTH 92 SWPM F + N AKD+ TH Sbjct 62 SWPMLFEVVNEAKDRRTH 79 > cpv:cgd4_1200 ubiquitin fusion degradation protein (UFD1); double Psi beta barrel fold ; K14016 ubiquitin fusion degradation protein 1 Length=322 Score = 88.2 bits (217), Expect = 7e-18, Method: Composition-based stats. Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 0/57 (0%) Query 36 FSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLTH 92 F Y+ YPVSFA +D LE GNKILLPPSAL+ LAR +I+WPM F+I NPAK+K TH Sbjct 44 FINEYSCYPVSFAGRDELEGGNKILLPPSALNQLARRNITWPMLFQISNPAKNKFTH 100 > pfa:PF14_0178 UFD1; Ubiquitin fusion degradation protein UFD1, putative; K14016 ubiquitin fusion degradation protein 1 Length=282 Score = 84.0 bits (206), Expect = 1e-16, Method: Composition-based stats. Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 0/57 (0%) Query 36 FSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLTH 92 F YT YPVSF KD +E+GNKI+LP +AL+ALAR HISWPM F + NP DK TH Sbjct 22 FQEEYTCYPVSFIGKDDMENGNKIILPQTALNALARRHISWPMLFEVSNPYTDKRTH 78 > tpv:TP02_0530 hypothetical protein; K14016 ubiquitin fusion degradation protein 1 Length=260 Score = 72.8 bits (177), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 36/79 (45%), Positives = 48/79 (60%), Gaps = 2/79 (2%) Query 15 MWDLGRSMASFWGGGG-EDGGGFSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLH 73 MW+ + +FW GG +++Y + VSFA ++ +E GNKILLP SALH LA + Sbjct 1 MWNWN-NFENFWSGGNIYQNAAHTSNYRCFSVSFAGRESMEQGNKILLPQSALHELASRN 59 Query 74 ISWPMHFRICNPAKDKLTH 92 ISWPM F I NP K T+ Sbjct 60 ISWPMMFEILNPKNYKRTN 78 > ath:AT2G21270 ubiquitin fusion degradation UFD1 family protein; K14016 ubiquitin fusion degradation protein 1 Length=319 Score = 72.8 bits (177), Expect = 3e-13, Method: Composition-based stats. Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%) Query 25 FWGGGGEDGGGFSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICN 84 F+ G G F SY YP SF K LESG+KI++PPSAL LA LHI +PM F + N Sbjct 2 FFDGYHYHGTTFEQSYRCYPASFIDKPQLESGDKIIMPPSALDRLASLHIDYPMLFELRN 61 Query 85 PAKDKLTHC 93 +++THC Sbjct 62 AGIERVTHC 70 > ath:AT4G38930 ubiquitin fusion degradation UFD1 family protein Length=311 Score = 70.1 bits (170), Expect = 2e-12, Method: Composition-based stats. Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 0/69 (0%) Query 25 FWGGGGEDGGGFSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICN 84 F+ G G F +Y YP SF K +ESG+KI++PPSAL LA L I +PM F + N Sbjct 2 FYDGYAYHGTTFEQTYRCYPSSFIDKPQIESGDKIIMPPSALDRLASLQIDYPMLFELRN 61 Query 85 PAKDKLTHC 93 + D +HC Sbjct 62 ASTDSFSHC 70 > bbo:BBOV_II005920 18.m06490; ubiquitin fusion degradation protein; K14016 ubiquitin fusion degradation protein 1 Length=258 Score = 68.2 bits (165), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%) Query 27 GGGGEDGGGFSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICNPA 86 GG DG F Y YPVSF KD +ESGNKI +P SAL+ LA +I+WPM F + N Sbjct 14 SGGYFDGLPFLVRYRCYPVSFLGKDAMESGNKICMPASALNELASRNITWPMMFELRNEE 73 Query 87 KDKLTH 92 + + TH Sbjct 74 RKRSTH 79 > dre:436724 ufd1l, wu:fc55f04, zgc:92341; ubiquitin fusion degradation 1-like; K14016 ubiquitin fusion degradation protein 1 Length=308 Score = 63.2 bits (152), Expect = 2e-10, Method: Composition-based stats. Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Query 36 FSASYTAYPVSFAA----KDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLT 91 FS Y Y VS A + +E G KI++PPSAL L+RL+I++PM F++ N D++T Sbjct 19 FSTQYRCYSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMT 78 Query 92 HC 93 HC Sbjct 79 HC 80 > xla:399034 ufd1l, MGC68571, ufd1; ubiquitin fusion degradation 1 like; K14016 ubiquitin fusion degradation protein 1 Length=307 Score = 63.2 bits (152), Expect = 2e-10, Method: Composition-based stats. Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Query 36 FSASYTAYPVSFAA----KDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLT 91 FS Y Y VS A + +E G KI++PPSAL L+RL+I++PM F++ N D++T Sbjct 19 FSTQYRCYSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMT 78 Query 92 HC 93 HC Sbjct 79 HC 80 > mmu:22230 Ufd1l, Ufd1; ubiquitin fusion degradation 1 like; K14016 ubiquitin fusion degradation protein 1 Length=307 Score = 61.6 bits (148), Expect = 5e-10, Method: Composition-based stats. Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Query 36 FSASYTAYPVSFAA----KDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLT 91 FS Y + VS A + +E G KI++PPSAL L+RL+I++PM F++ N D++T Sbjct 19 FSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMT 78 Query 92 HC 93 HC Sbjct 79 HC 80 > hsa:7353 UFD1L, UFD1; ubiquitin fusion degradation 1 like (yeast); K14016 ubiquitin fusion degradation protein 1 Length=266 Score = 61.2 bits (147), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Query 36 FSASYTAYPVSFAA----KDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLT 91 FS Y + VS A + +E G KI++PPSAL L+RL+I++PM F++ N D++T Sbjct 19 FSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMT 78 Query 92 HC 93 HC Sbjct 79 HC 80 > sce:YGR048W UFD1; Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol; K14016 ubiquitin fusion degradation protein 1 Length=361 Score = 44.3 bits (103), Expect = 1e-04, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Query 36 FSASYTAYPVSFA----AKDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLT 91 F + YP++ KD G KI LPPSAL L+ L+I +PM F++ ++T Sbjct 21 FEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVT 80 Query 92 H 92 H Sbjct 81 H 81 > ath:AT2G29070 ubiquitin fusion degradation UFD1 family protein Length=280 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 0/33 (0%) Query 61 LPPSALHALARLHISWPMHFRICNPAKDKLTHC 93 +PPSAL LA LHI +PM F++ N + +K +HC Sbjct 1 MPPSALDRLASLHIEYPMLFQLSNVSVEKTSHC 33 > cel:F19B6.2 ufd-1; Ubiquitin Fusion Degradation (yeast UFD homolog) family member (ufd-1); K14016 ubiquitin fusion degradation protein 1 Length=342 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%) Query 56 GNKILLPPSALHALARLHISWPMHFRICNPAKDKLTHC 93 G KILLP SAL+ L + +I PM F++ N A ++THC Sbjct 47 GGKILLPSSALNLLMQYNIPMPMLFKLTNMAVQRVTHC 84 > ath:AT2G47390 serine-type endopeptidase/ serine-type peptidase Length=961 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 20 RSMASFWGGGGEDGGGFSASYTAYPVSFAAKDHLESGNKILLPP 63 RS+AS GG EDGGG S + + D L G LPP Sbjct 71 RSLASACSGGAEDGGGTSNGSLSASATATEDDELAIGTGYRLPP 114 > mmu:52846 D1Bwg0212e, 2410015L18Rik, C40; DNA segment, Chr 1, Brigham & Women's Genetics 0212 expressed Length=505 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 10/66 (15%) Query 21 SMASFWGGGGEDGGGFSASYTAYPVSFAAKDHLESGNKIL-------LPPSALHALARLH 73 S+ S GGG G S ++ Y F+ DH G+ ++ L PSA L L+ Sbjct 68 SIISEEAGGGSTFEGLSTAFHHY---FSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALY 124 Query 74 ISWPMH 79 + W M+ Sbjct 125 LLWEMY 130 > hsa:55571 C2orf29; chromosome 2 open reading frame 29 Length=510 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 10/66 (15%) Query 21 SMASFWGGGGEDGGGFSASYTAYPVSFAAKDHLESGNKIL-------LPPSALHALARLH 73 S+ S GGG G S ++ Y F+ DH G+ ++ L PSA L L+ Sbjct 73 SIISEEAGGGSTFEGLSTAFHHY---FSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALY 129 Query 74 ISWPMH 79 + W M+ Sbjct 130 LLWEMY 135 Lambda K H 0.325 0.141 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2074765676 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40