bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3331_orf2 Length=119 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_049670 cysteine proteinase, putative (EC:3.4.22.1);... 73.6 2e-13 ath:AT3G06150 hypothetical protein 30.0 1.8 mmu:57257 Vav3, A530094I06Rik, AA986410, MGC27838; vav 3 oncog... 29.6 2.6 hsa:5276 SERPINI2, MEPI, PANCPIN, PI14, TSA2004; serpin peptid... 29.3 2.9 cel:C13G3.1 hypothetical protein 28.5 5.4 ath:AT4G23110 insulin-like growth factor binding 28.1 6.6 > tgo:TGME49_049670 cysteine proteinase, putative (EC:3.4.22.1); K01363 cathepsin B [EC:3.4.22.1] Length=572 Score = 73.6 bits (179), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 47/115 (40%), Positives = 63/115 (54%), Gaps = 6/115 (5%) Query 2 NEAAEHSGANTPIHGPVLKTLAEGEFWSSRPAVSNAALRHLRLKMQRMKLSAAEKGNNPE 61 +E A+ +G + LK E FW SRPA SNAA+ ++ KM++ E + Sbjct 166 SEQADEAGRDPGDLKKALKETGEDVFWESRPASSNAAVALIKRKMEKQAGKTGEGAGH-- 223 Query 62 LAVSWEAEVSPRFKYHSIKDAKRLMGTYLSWYEDPEKPAVPLGDPLPVKRFELQT 116 +WE EVS RF+Y S+KDAK+LMGT+L + P P G PLP K FE T Sbjct 224 ---TWEPEVSLRFRYLSLKDAKKLMGTFLVNTKVEGFP-TPKGMPLPAKEFENAT 274 > ath:AT3G06150 hypothetical protein Length=594 Score = 30.0 bits (66), Expect = 1.8, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 3 EAAEHSGANTPIHGPVLKTLAEGEFWSSRPAVSN 36 +A + SG N I G +T GE W SRP V + Sbjct 174 QAIDESGKNVCIGGDYFETDISGENWKSRPPVKD 207 > mmu:57257 Vav3, A530094I06Rik, AA986410, MGC27838; vav 3 oncogene; K05730 vav oncogene Length=847 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query 69 EVSPRFKYHSIKDAKRLMGTYLSW-YEDPEKPAVPLGD 105 E+ +K+HS+K+ R + T L + Y++PE+PA G+ Sbjct 741 ELVEYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGN 778 > hsa:5276 SERPINI2, MEPI, PANCPIN, PI14, TSA2004; serpin peptidase inhibitor, clade I (pancpin), member 2 Length=405 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 1 VNEAAEHSGANTPIHGPVLKTLAEGEFWSSRP 32 +NE + +T IH PV+ +LA+ +F ++ P Sbjct 339 INEDGSEAATSTGIHIPVIMSLAQSQFIANHP 370 > cel:C13G3.1 hypothetical protein Length=136 Score = 28.5 bits (62), Expect = 5.4, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 0/51 (0%) Query 44 LKMQRMKLSAAEKGNNPELAVSWEAEVSPRFKYHSIKDAKRLMGTYLSWYE 94 L +Q + L+ KG+NP S V+ K K RL+ T +S ++ Sbjct 84 LPVQHLNLNLVRKGSNPSSQTSRNNSVTDLLKSELFKMPSRLLSTAVSLHQ 134 > ath:AT4G23110 insulin-like growth factor binding Length=148 Score = 28.1 bits (61), Expect = 6.6, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 45 KMQRMKLSAAEKGNNPELAVSWEAEV 70 K Q + +EK NNPE +SWE EV Sbjct 119 KEQNKRRRISEKNNNPEETMSWEPEV 144 Lambda K H 0.312 0.129 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2022937320 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40