bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3226_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_052460 GPI transamidase 8, putative ; K06941 riboso... 68.9 4e-12 pfa:PF14_0066 radical SAM protein, putative; K06941 ribosomal ... 43.9 1e-04 bbo:BBOV_III008940 17.m07780; radical SAM domain containing pr... 42.4 4e-04 ath:AT2G39670 radical SAM domain-containing protein 40.4 0.002 tgo:TGME49_009790 radical SAM domain-containing protein (EC:1.... 29.3 3.2 tpv:TP01_0289 hypothetical protein; K12162 ubiquitin-fold modi... 28.9 3.9 cel:F11A6.1 kpc-1; Kex-2 Proprotein Convertase family member (... 28.9 4.1 cpv:cgd4_4100 hypothetical protein 28.9 4.1 dre:563626 fc59a02; wu:fc59a02 27.7 9.1 > tgo:TGME49_052460 GPI transamidase 8, putative ; K06941 ribosomal RNA large subunit methyltransferase N [EC:2.1.1.-] Length=270 Score = 68.9 bits (167), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 36/81 (44%), Positives = 51/81 (62%), Gaps = 10/81 (12%) Query 7 VPGVNDTVEHARALASLIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQGVSSSLRRAD 66 + G N+T EHA+ALA+L+R+RRR TRHLYHV++I YN AQGV SS++ Sbjct 157 IKGRNNTEEHAKALAALLRERRRPTRHLYHVNVIPYN----------TAQGVESSMQPPS 206 Query 67 SKRLKQFEEVLNGASISHSRR 87 + + F ++L +S SRR Sbjct 207 AAEVNHFTDLLRKLHLSVSRR 227 > pfa:PF14_0066 radical SAM protein, putative; K06941 ribosomal RNA large subunit methyltransferase N [EC:2.1.1.-] Length=362 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 11/82 (13%) Query 7 VPGVNDTVEHARALASLIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQGVSSSLRRA- 65 + +ND+ +HA AL+ I R R+LY+V LI YN+ A+ V + R Sbjct 255 IKNLNDSKDHAEALSDHICKRPNNIRYLYNVCLIPYNK----------AKNVDENFHRLD 304 Query 66 DSKRLKQFEEVLNGASISHSRR 87 D++++ QFE++L IS R Sbjct 305 DAEKILQFEKILKKNGISFFYR 326 > bbo:BBOV_III008940 17.m07780; radical SAM domain containing protein; K06941 ribosomal RNA large subunit methyltransferase N [EC:2.1.1.-] Length=336 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 7 VPGVNDTVEHARALASLIRDRRRTTRHLYHVSLIEYN 43 + G NDT EHA L +I +R R+LYHV+LI YN Sbjct 260 IKGENDTREHAEELVKVISNRPDEIRYLYHVNLIPYN 296 > ath:AT2G39670 radical SAM domain-containing protein Length=428 Score = 40.4 bits (93), Expect = 0.002, Method: Compositional matrix adjust. Identities = 30/90 (33%), Positives = 38/90 (42%), Gaps = 16/90 (17%) Query 9 GVNDTVEHARALASLIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQGVSSSLRRADSK 68 GVND VEHA LA L+R+ +T YHV+LI YN S +R K Sbjct 325 GVNDQVEHAVELAELLREWGKT----YHVNLIPYNPIE------------GSEYQRPYKK 368 Query 69 RLKQFEEVLNGASISHSRRWNHVADTTIMC 98 + F L I+ S R D + C Sbjct 369 AVLAFAAALESRKITASVRQTRGLDASAAC 398 > tgo:TGME49_009790 radical SAM domain-containing protein (EC:1.97.1.4) Length=619 Score = 29.3 bits (64), Expect = 3.2, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Query 10 VNDTVEHARALASLIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQ 56 VNDT+E A AL +++ R V+LI YN V D + Q Sbjct 384 VNDTLEQAHALGRILQPR----ADAVIVNLIPYNPTDVPYDYKPSTQ 426 > tpv:TP01_0289 hypothetical protein; K12162 ubiquitin-fold modifier 1 Length=998 Score = 28.9 bits (63), Expect = 3.9, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 0/52 (0%) Query 11 NDTVEHARALASLIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQGVSSSL 62 +D + H +AL S + + + H+SL EY+E+ + VD+ + +S + Sbjct 919 SDYISHIKALVSSVETLNSSLTNPKHISLSEYSESFLIVDIEMLKKQISRDI 970 > cel:F11A6.1 kpc-1; Kex-2 Proprotein Convertase family member (kpc-1) Length=760 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 7/75 (9%) Query 23 LIRDRRRTTRHLYHVSLIEYNEASVSVDVMCAAQGVSSSLRRADSKRLKQ-------FEE 75 L RD R+ +R + N+ DVM Q V+ + +R+++ FEE Sbjct 97 LFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRHTDDNDIFEE 156 Query 76 VLNGASISHSRRWNH 90 +G IS SR H Sbjct 157 DDDGTQISKSRNRKH 171 > cpv:cgd4_4100 hypothetical protein Length=312 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query 41 EYNEASVSVDVMCAAQGVSSSLRRADSKRLKQFEEVLNGASISHSRR--WN 89 EYN + ++ M G +SS R R Q +LNG S+ H +R WN Sbjct 195 EYNSSFITYANMQTDFGENSSFRLPSKARDSQSIIILNGISVIHMQRQHWN 245 > dre:563626 fc59a02; wu:fc59a02 Length=823 Score = 27.7 bits (60), Expect = 9.1, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Query 42 YNEASVSVDVMCAAQGVSSSLRRADSKRLKQFEEVLNGASISHSRRWNHVADTTIMCKL 100 Y + + +D + +AQ +S + L F + N IS++RRWN V T I +L Sbjct 747 YQDVLLQMDFIHSAQFLSRLPENTPAHTL--FSCIANTQMISNNRRWNQVFSTLIKDRL 803 Lambda K H 0.320 0.127 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2037741960 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40