bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3154_orf2 Length=51 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_016790 ABC transporter, putative (EC:1.2.7.8 3.6.3.... 84.7 6e-17 cpv:cgd1_980 RNase L inhibitor-like protein 83.6 1e-16 ath:AT3G13640 ATRLI1; ATRLI1; transporter 83.2 2e-16 pfa:MAL13P1.344 RNAse L inhibitor protein, putative; K06174 AT... 82.0 4e-16 ath:AT4G19210 ATRLI2; ATRLI2; transporter; K06174 ATP-binding ... 79.7 2e-15 mmu:24015 Abce1, C79080, Oabp, RLI, RNS41, Rnaseli; ATP-bindin... 77.8 7e-15 hsa:6059 ABCE1, ABC38, OABP, RLI, RNASEL1, RNASELI, RNS4I; ATP... 77.8 7e-15 dre:406324 abce1, MGC56045, wu:fb34c09, wu:fe47b01, wu:fi09g07... 75.5 4e-14 cel:Y39E4B.1 abce-1; ABC transporter, class E family member (a... 74.7 6e-14 sce:YDR091C RLI1; Essential iron-sulfur protein required for r... 73.6 1e-13 tpv:TP04_0855 RNAse L inhibitor; K06174 ATP-binding cassette, ... 72.4 3e-13 xla:380454 abce1, MGC53437; ATP-binding cassette, sub-family E... 72.0 4e-13 bbo:BBOV_III009450 17.m07819; ABC transporter, ATP-binding dom... 70.1 1e-12 > tgo:TGME49_016790 ABC transporter, putative (EC:1.2.7.8 3.6.3.24 3.6.3.25); K06174 ATP-binding cassette, sub-family E, member 1 Length=613 Score = 84.7 bits (208), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 38/49 (77%), Positives = 45/49 (91%), Gaps = 0/49 (0%) Query 2 LINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 L++GMN+FLK L ITFRRDPTNFRPRINK++S KDKEQKL GN+F+LDD Sbjct 564 LVSGMNRFLKSLEITFRRDPTNFRPRINKMESVKDKEQKLMGNYFMLDD 612 > cpv:cgd1_980 RNase L inhibitor-like protein Length=618 Score = 83.6 bits (205), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 36/49 (73%), Positives = 45/49 (91%), Gaps = 0/49 (0%) Query 2 LINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 L+ GMNKFLK+L I+FRRDP NFRPRINKLDS KDKEQK++GN+F+L++ Sbjct 570 LVTGMNKFLKILEISFRRDPMNFRPRINKLDSVKDKEQKMSGNYFLLEE 618 > ath:AT3G13640 ATRLI1; ATRLI1; transporter Length=603 Score = 83.2 bits (204), Expect = 2e-16, Method: Composition-based stats. Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 SL++GMN FL LNITFRRDPTNFRPRINKL+S KDKEQK G+++ LDD Sbjct 554 SLLSGMNHFLSHLNITFRRDPTNFRPRINKLESIKDKEQKTAGSYYYLDD 603 > pfa:MAL13P1.344 RNAse L inhibitor protein, putative; K06174 ATP-binding cassette, sub-family E, member 1 Length=619 Score = 82.0 bits (201), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L GMNKFLK++++TFRRDP+N+RPRINK DS KDKEQKLNG +F++D+ Sbjct 570 TLAAGMNKFLKIIDVTFRRDPSNYRPRINKYDSVKDKEQKLNGTYFIIDE 619 > ath:AT4G19210 ATRLI2; ATRLI2; transporter; K06174 ATP-binding cassette, sub-family E, member 1 Length=605 Score = 79.7 bits (195), Expect = 2e-15, Method: Composition-based stats. Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 SL++GMN FL LNITFRRDPTNFRPRINKL+S KD+EQK G+++ LDD Sbjct 556 SLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605 > mmu:24015 Abce1, C79080, Oabp, RLI, RNS41, Rnaseli; ATP-binding cassette, sub-family E (OABP), member 1; K06174 ATP-binding cassette, sub-family E, member 1 Length=599 Score = 77.8 bits (190), Expect = 7e-15, Method: Composition-based stats. Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP N+RPRINKL+S KD EQK +GN+F LDD Sbjct 550 TLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > hsa:6059 ABCE1, ABC38, OABP, RLI, RNASEL1, RNASELI, RNS4I; ATP-binding cassette, sub-family E (OABP), member 1; K06174 ATP-binding cassette, sub-family E, member 1 Length=599 Score = 77.8 bits (190), Expect = 7e-15, Method: Composition-based stats. Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP N+RPRINKL+S KD EQK +GN+F LDD Sbjct 550 TLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > dre:406324 abce1, MGC56045, wu:fb34c09, wu:fe47b01, wu:fi09g07, zgc:111906, zgc:56045; ATP-binding cassette, sub-family E (OABP), member 1; K06174 ATP-binding cassette, sub-family E, member 1 Length=599 Score = 75.5 bits (184), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP NFRPRINKL+S KD EQK +GN+F LDD Sbjct 550 TLLAGMNKFLAQLEITFRRDPNNFRPRINKLNSIKDVEQKKSGNYFFLDD 599 > cel:Y39E4B.1 abce-1; ABC transporter, class E family member (abce-1); K06174 ATP-binding cassette, sub-family E, member 1 Length=610 Score = 74.7 bits (182), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 0/51 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDDN 51 SL+ GMN+FLK+L+ITFRRD +RPRINKLDS KD +QK +G FF LDDN Sbjct 560 SLLEGMNRFLKMLDITFRRDQETYRPRINKLDSVKDVDQKKSGQFFFLDDN 610 > sce:YDR091C RLI1; Essential iron-sulfur protein required for ribosome biogenesis and translation initiation; facilitates binding of a multifactor complex (MFC) of translation initiation factors to the small ribosomal subunit; predicted ABC family ATPase; K06174 ATP-binding cassette, sub-family E, member 1 Length=608 Score = 73.6 bits (179), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 0/51 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDDN 51 SL+ G N+FLK LN+TFRRDP +FRPRINKLDS DKEQK +GN+F LD+ Sbjct 556 SLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNYFFLDNT 606 > tpv:TP04_0855 RNAse L inhibitor; K06174 ATP-binding cassette, sub-family E, member 1 Length=636 Score = 72.4 bits (176), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 0/48 (0%) Query 2 LINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLD 49 L G N+FLK L++TFRRDPTN+RPRINK DS KDKEQK +G +F +D Sbjct 588 LATGFNRFLKSLDVTFRRDPTNYRPRINKYDSVKDKEQKASGLYFTMD 635 > xla:380454 abce1, MGC53437; ATP-binding cassette, sub-family E (OABP), member 1; K06174 ATP-binding cassette, sub-family E, member 1 Length=599 Score = 72.0 bits (175), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP N+RPRINK++S KD +QK +GN+F LDD Sbjct 550 TLLAGMNKFLSQLEITFRRDPNNYRPRINKMNSIKDVDQKKSGNYFFLDD 599 > bbo:BBOV_III009450 17.m07819; ABC transporter, ATP-binding domain containing protein; K06174 ATP-binding cassette, sub-family E, member 1 Length=616 Score = 70.1 bits (170), Expect = 1e-12, Method: Composition-based stats. Identities = 30/48 (62%), Positives = 39/48 (81%), Gaps = 0/48 (0%) Query 2 LINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLD 49 L+ G N+FLK L++TFRRD NFRPRINK DS KDKEQK +G++F ++ Sbjct 568 LVVGFNRFLKSLDVTFRRDQANFRPRINKYDSVKDKEQKASGDYFSVE 615 Lambda K H 0.323 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2026933688 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40