bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3021_orf1 Length=63 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_027600 ribosomal protein L34, putative ; K02915 lar... 88.6 4e-18 tpv:TP03_0488 60S ribosomal protein L34a; K02915 large subunit... 63.2 2e-10 cpv:cgd8_3480 60S ribosomal protein L34 ; K02915 large subunit... 62.8 2e-10 sce:YIL052C RPL34B; L34B; K02915 large subunit ribosomal prote... 60.8 1e-09 sce:YER056C-A RPL34A; L34A; K02915 large subunit ribosomal pro... 60.8 1e-09 bbo:BBOV_IV001680 21.m02928; ribosomal protein L34; K02915 lar... 60.5 1e-09 ath:AT1G26880 60S ribosomal protein L34 (RPL34A); K02915 large... 48.9 4e-06 ath:AT1G69620 RPL34; RPL34 (RIBOSOMAL PROTEIN L34); structural... 47.0 1e-05 ath:AT3G28900 60S ribosomal protein L34 (RPL34C); K02915 large... 46.6 2e-05 pfa:PF07_0043 60S ribosomal protein L34-A, putative; K02915 la... 46.2 3e-05 xla:447134 rpl34, MGC85388; ribosomal protein L34; K02915 larg... 44.3 9e-05 xla:380526 rpl34, MGC64481, xl34; ribosomal protein L34; K0291... 44.3 9e-05 mmu:68436 Rpl34, 1100001I22Rik, MGC103270; ribosomal protein L... 44.3 9e-05 mmu:619547 Rpl34-ps1, EG619547, Gm10239, MGC103270, MGC117759;... 44.3 9e-05 mmu:100043876 Gm4705; predicted gene 4705; K02915 large subuni... 44.3 9e-05 hsa:6164 RPL34, MGC111005; ribosomal protein L34; K02915 large... 43.9 1e-04 dre:394097 rpl34, MGC56455, zgc:56455, zgc:77706; ribosomal pr... 43.1 2e-04 cel:C42C1.14 rpl-34; Ribosomal Protein, Large subunit family m... 42.7 3e-04 mmu:623174 Gm6404, EG623174; predicted gene 6404 42.4 mmu:100040611 Gm10154; predicted gene 10154 42.4 mmu:100042557 Gm10086; ribosomal protein L34 pseudogene 41.6 6e-04 mmu:100039353 Gm2178; predicted gene 2178 33.5 cel:F26F12.3 hypothetical protein 32.3 0.37 > tgo:TGME49_027600 ribosomal protein L34, putative ; K02915 large subunit ribosomal protein L34e Length=134 Score = 88.6 bits (218), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 44/61 (72%), Positives = 50/61 (81%), Gaps = 0/61 (0%) Query 1 AKVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVRE 60 AKVV+ NV KQ SR KCG C R LPGIPA P + RLLKKRERTV+RAYGG+RCH+CVRE Sbjct 28 AKVVFHNVGKQPSRPKCGNCHRALPGIPAVAPHRLRLLKKRERTVHRAYGGSRCHACVRE 87 Query 61 K 61 + Sbjct 88 R 88 > tpv:TP03_0488 60S ribosomal protein L34a; K02915 large subunit ribosomal protein L34e Length=138 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 29/61 (47%), Positives = 44/61 (72%), Gaps = 0/61 (0%) Query 1 AKVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVRE 60 A++V N++K R +CG C R L G+ A RP ++ LK+R RTV+R YGG+RCH+CV++ Sbjct 28 ARLVLHNLKKVGKRPRCGDCKRTLAGVSAVRPFLYKNLKRRNRTVSRPYGGSRCHNCVKD 87 Query 61 K 61 + Sbjct 88 R 88 > cpv:cgd8_3480 60S ribosomal protein L34 ; K02915 large subunit ribosomal protein L34e Length=138 Score = 62.8 bits (151), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 0/55 (0%) Query 7 NVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 N+ K SR KCG C + L GIPA P + + LKKRERTV RAYGGT+C +CVR++ Sbjct 37 NIGKVYSRPKCGDCKKPLAGIPACAPYEMKHLKKRERTVARAYGGTKCPTCVRQR 91 > sce:YIL052C RPL34B; L34B; K02915 large subunit ribosomal protein L34e Length=121 Score = 60.8 bits (146), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 0/55 (0%) Query 7 NVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 +V+K A+R KCG CG L GI RP Q+ + K +TV+RAYGG+RC +CV+E+ Sbjct 34 HVKKLATRPKCGDCGSALQGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKER 88 > sce:YER056C-A RPL34A; L34A; K02915 large subunit ribosomal protein L34e Length=121 Score = 60.8 bits (146), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 0/55 (0%) Query 7 NVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 +V+K A+R KCG CG L GI RP Q+ + K +TV+RAYGG+RC +CV+E+ Sbjct 34 HVKKLATRPKCGDCGSALQGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKER 88 > bbo:BBOV_IV001680 21.m02928; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=157 Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 0/46 (0%) Query 16 KCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 KCG C L GIPA RP +R LKKRER V+RAYGG RCH CV+++ Sbjct 43 KCGDCKCKLAGIPALRPHLYRNLKKRERRVSRAYGGVRCHKCVKDR 88 > ath:AT1G26880 60S ribosomal protein L34 (RPL34A); K02915 large subunit ribosomal protein L34e Length=96 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Query 1 AKVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFR--LLKKRERTVNRAYGGTRCHSCV 58 K+VY +K+AS KC G+ + GIP RP +++ L + RTVNRAYGG S V Sbjct 28 GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPSEYKRSRLSRNRRTVNRAYGGVLSGSAV 87 Query 59 REK 61 RE+ Sbjct 88 RER 90 > ath:AT1G69620 RPL34; RPL34 (RIBOSOMAL PROTEIN L34); structural constituent of ribosome; K02915 large subunit ribosomal protein L34e Length=119 Score = 47.0 bits (110), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFR--LLKKRERTVNRAYGGTRCHSCVR 59 K+ Y +K+AS KC G+ + GIP RP +++ L + RTVNRAYGG S VR Sbjct 29 KLTYQTTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVR 88 Query 60 EK 61 E+ Sbjct 89 ER 90 > ath:AT3G28900 60S ribosomal protein L34 (RPL34C); K02915 large subunit ribosomal protein L34e Length=120 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Query 2 KVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFR--LLKKRERTVNRAYGGTRCHSCVR 59 K+ Y K+AS KC G+ + GIP RP +++ L + ERTVNRAYGG VR Sbjct 29 KLTYQTTNKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLARNERTVNRAYGGVLSGVAVR 88 Query 60 EK 61 E+ Sbjct 89 ER 90 > pfa:PF07_0043 60S ribosomal protein L34-A, putative; K02915 large subunit ribosomal protein L34e Length=150 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 0/54 (0%) Query 8 VRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 V+K+A + KC C + G+ A RP +++ RTV RAYGG+ C C+RE+ Sbjct 35 VKKKAGKPKCADCKTAIQGVKALRPADNYRARRKNRTVARAYGGSICARCIRER 88 > xla:447134 rpl34, MGC85388; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=117 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L GI A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGICPGRLRGIRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > xla:380526 rpl34, MGC64481, xl34; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=117 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L GI A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGICPGRLRGIRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > mmu:68436 Rpl34, 1100001I22Rik, MGC103270; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=117 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > mmu:619547 Rpl34-ps1, EG619547, Gm10239, MGC103270, MGC117759; ribosomal protein L34, pseudogene 1 Length=117 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > mmu:100043876 Gm4705; predicted gene 4705; K02915 large subunit ribosomal protein L34e Length=117 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > hsa:6164 RPL34, MGC111005; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=117 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > dre:394097 rpl34, MGC56455, zgc:56455, zgc:77706; ribosomal protein L34; K02915 large subunit ribosomal protein L34e Length=117 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K ++ + CG C L GI A RP L K ++ V+RAYGG+ C CVR Sbjct 29 RIVYLYTKKTGKSPKSACGICPGRLRGIRAVRPQVLMRLSKTKKHVSRAYGGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > cel:C42C1.14 rpl-34; Ribosomal Protein, Large subunit family member (rpl-34); K02915 large subunit ribosomal protein L34e Length=110 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 0/60 (0%) Query 2 KVVYLNVRKQASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVREK 61 ++V ++K+ KC G L GI RP RLLK+ ERTV RAYGG + V+E+ Sbjct 29 RLVVQYIKKRGQIPKCRDTGVKLHGITPARPIALRLLKRNERTVTRAYGGCLSPNAVKER 88 > mmu:623174 Gm6404, EG623174; predicted gene 6404 Length=117 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYG + C C+R Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKQVSRAYGSSMCAKCIR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > mmu:100040611 Gm10154; predicted gene 10154 Length=117 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCVR 59 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAY G+ C CVR Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYDGSMCAKCVR 88 Query 60 EK 61 ++ Sbjct 89 DR 90 > mmu:100042557 Gm10086; ribosomal protein L34 pseudogene Length=117 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRLLKKRERTVNRAYGGTRCHSCV 58 ++VYL +K +A + CG C L G+ A RP L K ++ V+RAYGG+ C CV Sbjct 29 RIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCV 87 > mmu:100039353 Gm2178; predicted gene 2178 Length=118 Score = 33.5 bits (75), Expect = 0.17, Method: Compositional matrix adjust. Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query 2 KVVYLNVRK--QASRQKCGGCGRLLPGIPARRPPQFRL-LKKRERTVNRAYGGTRCHSCV 58 ++VYL +K +A + CG C L G+PA R + L K + V+RAY + C CV Sbjct 29 RIVYLYTKKVGKAPKSACGVCPLRLQGLPAVRARVVLMRLSKTKMQVSRAYSCSMCAKCV 88 > cel:F26F12.3 hypothetical protein Length=890 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 0/19 (0%) Query 6 LNVRKQASRQKCGGCGRLL 24 + VR QASR +CGGCGR+ Sbjct 708 MEVRDQASRAECGGCGRVF 726 Lambda K H 0.325 0.138 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2056037364 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40