bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2881_orf2 Length=62 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_104460 zinc finger (C3HC4 RING finger) protein, put... 61.2 8e-10 pfa:PF14_0215 conserved Plasmodium membrane protein, unknown f... 56.2 2e-08 tpv:TP01_0655 hypothetical protein 45.8 3e-05 cpv:cgd8_2560 HRD1 like membrane associated RING finger contai... 42.0 4e-04 bbo:BBOV_IV010180 23.m06036; zinc finger, C3HC4 type domain co... 41.2 0.001 ath:AT3G16090 zinc finger (C3HC4-type RING finger) family prot... 37.7 0.009 xla:494996 syvn1-b, hrd1; synovial apoptosis inhibitor 1, syno... 37.0 0.016 xla:431869 syvn1-a, MGC83718, hrd1; synovial apoptosis inhibit... 36.2 0.025 dre:335226 syvn1, wu:fk91f10, zgc:55735, zgc:77108; synovial a... 33.1 0.22 mmu:74126 Syvn1, 1200010C09Rik, AW211966, C85322, D530017H19Ri... 32.3 0.37 hsa:84447 SYVN1, HRD1, KIAA1810, MGC40372; synovial apoptosis ... 32.3 0.37 ath:AT1G08800 hypothetical protein 29.6 2.5 > tgo:TGME49_104460 zinc finger (C3HC4 RING finger) protein, putative ; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=710 Score = 61.2 bits (147), Expect = 8e-10, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 0/61 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLDNGR 61 + ++E YT V L++ K+ALA+ YN ++FL K + L+VG LR LE+EQV+D+GR Sbjct 27 WYVHEELYTVVAVLSTGKIALALFYNCAFMLFLGLGKLAMRLMVGSLRDLEMEQVIDSGR 86 Query 62 G 62 G Sbjct 87 G 87 > pfa:PF14_0215 conserved Plasmodium membrane protein, unknown function; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=510 Score = 56.2 bits (134), Expect = 2e-08, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%) Query 6 DEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLDNGRG 62 DEFY AVV L++ K I YNF L++F++ K +L++ +G LR LEVEQ++DN R Sbjct 28 DEFYLAVVYLSTEKFPRTIIYNFFLMVFIVLCKLLLNVFIGELRYLEVEQLIDNARA 84 > tpv:TP01_0655 hypothetical protein Length=618 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 0/55 (0%) Query 8 FYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLDNGRG 62 FY + + SNK LAI YN+CL++++ K + + +G L +LE E++++N R Sbjct 31 FYDIITRFLSNKTCLAILYNYCLMLYIYCCKIPIFIFLGTLTQLESEELIENIRN 85 > cpv:cgd8_2560 HRD1 like membrane associated RING finger containing protein signal peptide plus 6 transmembrane domains ; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=637 Score = 42.0 bits (97), Expect = 4e-04, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 0/54 (0%) Query 8 FYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLDNGR 61 FY ++ + K + I N LL K IL++ VGRLR +E+E+++D GR Sbjct 41 FYHIIMHITITKASTMIITNAGLLTLYFLGKVILNMFVGRLRDIELEEIIDQGR 94 > bbo:BBOV_IV010180 23.m06036; zinc finger, C3HC4 type domain containing protein Length=1151 Score = 41.2 bits (95), Expect = 0.001, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%) Query 8 FYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLDNGR 61 FY +V SNK +A+ YN+ L+ F++ + + +GRL ++E EQ+ + R Sbjct 34 FYEFIVFYMSNKTCVAVMYNYLLMWFIVMSILFVRIFLGRLSQMEREQLYEMTR 87 > ath:AT3G16090 zinc finger (C3HC4-type RING finger) family protein; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=492 Score = 37.7 bits (86), Expect = 0.009, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 7 EFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQV 56 +FY A V L+++K++L + N CL++ L + + +G LR EVE++ Sbjct 28 QFYPATVYLSTSKISLVLLLNMCLVLMLSLWHLVKFVFLGSLREAEVERL 77 > xla:494996 syvn1-b, hrd1; synovial apoptosis inhibitor 1, synoviolin; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=595 Score = 37.0 bits (84), Expect = 0.016, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y ++FY VV L + ++AI Y ++ L KF+ + G+LR E+E +L+ Sbjct 17 YYLKNQFYPTVVYLTKSSPSMAILYIQAFVLVFLLGKFMGKVFFGQLRAAEMEHLLE 73 > xla:431869 syvn1-a, MGC83718, hrd1; synovial apoptosis inhibitor 1, synoviolin; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=605 Score = 36.2 bits (82), Expect = 0.025, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y ++FY VV L + ++A+ Y ++ L KF+ + G+LR E+E +L+ Sbjct 17 YYLKNQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKFMGKVFFGQLRAAEMEHLLE 73 > dre:335226 syvn1, wu:fk91f10, zgc:55735, zgc:77108; synovial apoptosis inhibitor 1, synoviolin (EC:6.3.2.-); K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=625 Score = 33.1 bits (74), Expect = 0.22, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y +FY VV L + ++A+ Y ++ L K + + G+LR E+E +++ Sbjct 23 YFLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKLMRKVFFGQLRAAEMEHLIE 79 > mmu:74126 Syvn1, 1200010C09Rik, AW211966, C85322, D530017H19Rik, Hrd1; synovial apoptosis inhibitor 1, synoviolin; K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=612 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y +FY VV L + ++A+ Y ++ L K + + G+LR E+E +L+ Sbjct 23 YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLE 79 > hsa:84447 SYVN1, HRD1, KIAA1810, MGC40372; synovial apoptosis inhibitor 1, synoviolin (EC:6.3.2.-); K10601 E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19] Length=616 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y +FY VV L + ++A+ Y ++ L K + + G+LR E+E +L+ Sbjct 23 YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLE 79 > ath:AT1G08800 hypothetical protein Length=1113 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 21 ALAIEYNFCLLMFLLFVKFILHLLVGRL 48 ALA+ +N LLMF+LFV I ++ R Sbjct 9 ALALAFNEWLLMFMLFVNSIFSYVIARF 36 Lambda K H 0.335 0.151 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2060478756 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40