bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2860_orf2 Length=56 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_016400 meiotic recombination protein DMC1-like prot... 107 1e-23 pfa:MAL8P1.76 meiotic recombination protein dmc1-like protein;... 97.4 1e-20 cpv:cgd7_1690 meiotic recombination protein DMC1-like protein ... 95.1 4e-20 sce:YER179W DMC1, ISC2; Dmc1p; K10872 meiotic recombination pr... 93.6 1e-19 ath:AT3G22880 DMC1; DMC1 (DISRUPTION OF MEIOTIC CONTROL 1); AT... 82.8 3e-16 dre:553953 dmc1, MGC136628, zgc:136628; DMC1 dosage suppressor... 81.6 6e-16 mmu:19361 Rad51, AV304093, Rad51a, Reca; RAD51 homolog (S. cer... 78.6 4e-15 mmu:13404 Dmc1, Dmc1h, MGC151144, Mei11, sgdp; DMC1 dosage sup... 78.6 5e-15 hsa:11144 DMC1, DMC1H, HsLim15, LIM15, MGC150472, MGC150473, d... 77.8 7e-15 dre:406487 rad51, wu:fb38e12, zgc:77754; RAD51 homolog (RecA h... 77.8 7e-15 cel:Y43C5A.6 rad-51; RADiation sensitivity abnormal/yeast RAD-... 77.8 7e-15 xla:380251 rad51-b, MGC130792, MGC52570, brcc5, rad51, rad51a,... 77.8 9e-15 xla:397726 rad51-a, MGC84850, brcc5, rad51, rad51a, reca, xrad... 77.0 1e-14 ath:AT5G20850 ATRAD51; ATP binding / DNA binding / DNA-depende... 76.6 2e-14 sce:YER095W RAD51, MUT5; Rad51p; K04482 DNA repair protein RAD51 76.3 2e-14 cpv:cgd5_410 Rad51 ; K04482 DNA repair protein RAD51 74.3 9e-14 tpv:TP04_0170 meiotic recombination protein DMC1; K04482 DNA r... 72.8 2e-13 hsa:5888 RAD51, BRCC5, HRAD51, HsRad51, HsT16930, RAD51A, RECA... 72.8 3e-13 tgo:TGME49_072900 DNA repair protein, putative (EC:3.6.3.8); K... 71.2 7e-13 pfa:PF11_0087 rad51; Rad51 homolog; K04482 DNA repair protein ... 68.6 4e-12 bbo:BBOV_II003540 18.m06297; Rad51 protein; K04482 DNA repair ... 67.0 1e-11 tpv:TP04_0230 DNA repair protein Rad51; K04482 DNA repair prot... 67.0 1e-11 dre:406721 rad51l1, wu:fd07f04, zgc:56581; RAD51-like 1 (S. ce... 55.1 5e-08 ath:AT2G45280 ATRAD51C; ATP binding / damaged DNA binding / pr... 55.1 5e-08 sce:YDR004W RAD57; Protein that stimulates strand exchange by ... 54.7 6e-08 hsa:5890 RAD51L1, MGC34245, R51H2, RAD51B, REC2, hREC2; RAD51-... 53.9 1e-07 mmu:19363 Rad51l1, AI553500, R51H2, Rad51b, mREC2; RAD51-like ... 52.4 4e-07 dre:450081 rad51c, zgc:101596; rad51 homolog C (S. cerevisiae)... 49.7 2e-06 xla:379577 xrcc3, MGC69118; X-ray repair complementing defecti... 49.3 3e-06 mmu:114714 Rad51c, R51H3, Rad51l2; RAD51 homolog c (S. cerevis... 48.5 5e-06 dre:541414 xrcc3, im:7142103, si:dkey-11b8.1, zgc:101608; X-ra... 48.1 6e-06 ath:AT5G57450 XRCC3; XRCC3; ATP binding / damaged DNA binding ... 47.0 2e-05 hsa:7517 XRCC3, CMM6; X-ray repair complementing defective rep... 45.1 6e-05 mmu:74335 Xrcc3, 4432412E01Rik, AI182522, AW537713; X-ray repa... 44.7 8e-05 ath:AT2G28560 RAD51B; RAD51B; recombinase; K10869 RAD51-like p... 43.1 2e-04 cpv:cgd2_4070 hypothetical protein 33.1 0.22 mmu:19364 Rad51l3, DKFZp586D0122, R51H3, Rad51d, Trad-d2, Trad... 31.2 0.72 dre:404608 MGC77165; zgc:77165; K10871 RAD51-like protein 3 30.4 ath:AT1G07745 RAD51D; RAD51D (ARABIDOPSIS HOMOLOG OF RAD51 D);... 30.0 1.9 cpv:cgd2_3880 hypothetical protein 30.0 2.0 hsa:5892 RAD51L3, R51H3, RAD51D, TRAD; RAD51-like 3 (S. cerevi... 29.6 2.1 xla:444788 rad51l3, MGC82048; RAD51-like 3; K10871 RAD51-like ... 29.3 3.4 cpv:cgd4_2050 hypothetical protein 28.1 7.8 eco:b2699 recA, ECK2694, JW2669, lexB, recH, rnmB, srf, tif, u... 27.7 8.4 tpv:TP04_0453 hypothetical protein 27.7 8.6 > tgo:TGME49_016400 meiotic recombination protein DMC1-like protein, putative (EC:2.7.11.1); K10872 meiotic recombination protein DMC1 Length=349 Score = 107 bits (267), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 47/56 (83%), Positives = 52/56 (92%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 DQLLGGG E+MSI E+FGENRCGKTQ+CHT+CVTAQLPR+M GGCGKVCYIDTE T Sbjct 120 DQLLGGGFETMSITELFGENRCGKTQLCHTVCVTAQLPRDMKGGCGKVCYIDTEGT 175 > pfa:MAL8P1.76 meiotic recombination protein dmc1-like protein; K10872 meiotic recombination protein DMC1 Length=347 Score = 97.4 bits (241), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 44/56 (78%), Positives = 48/56 (85%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 DQ LGGGIESM I E+FGENRCGKTQ+CHTL VTAQLP+ + GG GKVCYIDTE T Sbjct 118 DQTLGGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNGKVCYIDTEGT 173 > cpv:cgd7_1690 meiotic recombination protein DMC1-like protein ; K10872 meiotic recombination protein DMC1 Length=342 Score = 95.1 bits (235), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 44/56 (78%), Positives = 47/56 (83%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D++L GG ESM I EIFGENRCGKTQICHTLCV AQLP EM GG GKVC+IDTE T Sbjct 113 DKMLMGGFESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFIDTEGT 168 > sce:YER179W DMC1, ISC2; Dmc1p; K10872 meiotic recombination protein DMC1 Length=334 Score = 93.6 bits (231), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 43/56 (76%), Positives = 47/56 (83%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D +LGGGI +MSI E+FGE RCGKTQ+ HTLCVT QLPREMGGG GKV YIDTE T Sbjct 104 DSILGGGIMTMSITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGT 159 > ath:AT3G22880 DMC1; DMC1 (DISRUPTION OF MEIOTIC CONTROL 1); ATP binding / DNA binding / DNA-dependent ATPase/ damaged DNA binding / nucleoside-triphosphatase/ nucleotide binding / protein binding; K10872 meiotic recombination protein DMC1 Length=344 Score = 82.8 bits (203), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 39/56 (69%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D LLGGGIE+ +I E FGE R GKTQ+ HTLCVT QLP M GG GKV YIDTE T Sbjct 116 DDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGT 171 > dre:553953 dmc1, MGC136628, zgc:136628; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); K10872 meiotic recombination protein DMC1 Length=342 Score = 81.6 bits (200), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 39/56 (69%), Positives = 44/56 (78%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LLGGG+ESM+I E FGE R GKTQ+ HTLCVTAQLP E G GKV +IDTE T Sbjct 111 DKLLGGGVESMAITEAFGEFRTGKTQLSHTLCVTAQLPGEYGYTGGKVIFIDTENT 166 > mmu:19361 Rad51, AV304093, Rad51a, Reca; RAD51 homolog (S. cerevisiae); K04482 DNA repair protein RAD51 Length=339 Score = 78.6 bits (192), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 39/56 (69%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GGIE+ SI E+FGE R GKTQICHTL VT QLP + GGG GK YIDTE T Sbjct 110 DKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGT 165 > mmu:13404 Dmc1, Dmc1h, MGC151144, Mei11, sgdp; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); K10872 meiotic recombination protein DMC1 Length=340 Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LLGGGIESM+I E FGE R GKTQ+ HTLCVTAQLP G GK+ +IDTE T Sbjct 109 DKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGTGGYSGGKIIFIDTENT 164 > hsa:11144 DMC1, DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); K10872 meiotic recombination protein DMC1 Length=340 Score = 77.8 bits (190), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LLGGGIESM+I E FGE R GKTQ+ HTLCVTAQLP G GK+ +IDTE T Sbjct 109 DKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENT 164 > dre:406487 rad51, wu:fb38e12, zgc:77754; RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae); K04482 DNA repair protein RAD51 Length=338 Score = 77.8 bits (190), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GGIE+ SI E+FGE R GKTQ+CHTL VT QLP + GGG GK YIDTE T Sbjct 109 DKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGT 164 > cel:Y43C5A.6 rad-51; RADiation sensitivity abnormal/yeast RAD-related family member (rad-51); K04482 DNA repair protein RAD51 Length=395 Score = 77.8 bits (190), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 37/56 (66%), Positives = 44/56 (78%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LLGGGIE+ SI E++GE R GKTQ+CH+L V QLP +MGGG GK YIDT AT Sbjct 164 DRLLGGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDTNAT 219 > xla:380251 rad51-b, MGC130792, MGC52570, brcc5, rad51, rad51a, reca, xrad51; RAD51 homolog (RecA homolog); K04482 DNA repair protein RAD51 Length=336 Score = 77.8 bits (190), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GGIE+ SI E+FGE R GKTQ+CHTL VT QLP + GGG GK YIDTE T Sbjct 107 DKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGT 162 > xla:397726 rad51-a, MGC84850, brcc5, rad51, rad51a, reca, xrad51; RAD51 homolog (RecA homolog); K04482 DNA repair protein RAD51 Length=336 Score = 77.0 bits (188), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GG+E+ SI E+FGE R GKTQ+CHTL VT QLP + GGG GK YIDTE T Sbjct 107 DKLLQGGVETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGT 162 > ath:AT5G20850 ATRAD51; ATP binding / DNA binding / DNA-dependent ATPase/ damaged DNA binding / nucleoside-triphosphatase/ nucleotide binding / protein binding / sequence-specific DNA binding; K04482 DNA repair protein RAD51 Length=342 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 36/56 (64%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D++L GGIE+ SI E++GE R GKTQ+CHTLCVT QLP + GGG GK YID E T Sbjct 113 DKVLEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGT 168 > sce:YER095W RAD51, MUT5; Rad51p; K04482 DNA repair protein RAD51 Length=400 Score = 76.3 bits (186), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 36/56 (64%), Positives = 44/56 (78%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D LLGGG+E+ SI E+FGE R GK+Q+CHTL VT Q+P ++GGG GK YIDTE T Sbjct 168 DTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGT 223 > cpv:cgd5_410 Rad51 ; K04482 DNA repair protein RAD51 Length=347 Score = 74.3 bits (181), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 38/56 (67%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GGIE+ SI EIFGE R GKTQ+CHTL VT QLP E GG GK +IDTE T Sbjct 116 DRLLQGGIETGSITEIFGEFRTGKTQLCHTLAVTCQLPVEHKGGEGKCLWIDTEGT 171 > tpv:TP04_0170 meiotic recombination protein DMC1; K04482 DNA repair protein RAD51 Length=346 Score = 72.8 bits (177), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/58 (63%), Positives = 44/58 (75%), Gaps = 6/58 (10%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQL--PREMGGGCGKVCYIDTEAT 56 ++LL GGIE+MSI E+FGENR GKTQICHT+ VT+Q+ P E KVCYIDTE T Sbjct 119 NRLLNGGIETMSITELFGENRTGKTQICHTISVTSQIINPTE----PFKVCYIDTENT 172 > hsa:5888 RAD51, BRCC5, HRAD51, HsRad51, HsT16930, RAD51A, RECA; RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae); K04482 DNA repair protein RAD51 Length=340 Score = 72.8 bits (177), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 36/51 (70%), Positives = 39/51 (76%), Gaps = 0/51 (0%) Query 6 GGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 GGIE+ SI E+FGE R GKTQICHTL VT QLP + GGG GK YIDTE T Sbjct 116 GGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGT 166 > tgo:TGME49_072900 DNA repair protein, putative (EC:3.6.3.8); K04482 DNA repair protein RAD51 Length=354 Score = 71.2 bits (173), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D LL GGIE+ ++ E+FGE R GKTQ+CHTL VT QLP E GG GK +IDTE T Sbjct 123 DSLLKGGIETGNLTELFGEFRTGKTQLCHTLAVTCQLPIEQAGGEGKCLWIDTEGT 178 > pfa:PF11_0087 rad51; Rad51 homolog; K04482 DNA repair protein RAD51 Length=350 Score = 68.6 bits (166), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D LL GGIE+ I E+FGE R GK+Q+CHTL +T QLP E GG GK +IDTE T Sbjct 120 DALLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGT 175 > bbo:BBOV_II003540 18.m06297; Rad51 protein; K04482 DNA repair protein RAD51 Length=346 Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D LL GGIES SI EI G+ GKTQ+CHTL +T+QLP E GG GK +IDT+ Sbjct 113 DALLQGGIESGSITEIIGDFSTGKTQLCHTLAITSQLPIEQNGGEGKCLWIDTQ 166 > tpv:TP04_0230 DNA repair protein Rad51; K04482 DNA repair protein RAD51 Length=343 Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D+LL GG+E+ SI EI GE + GK+Q+CHTL VT QLP E GG GK ++D+E T Sbjct 113 DKLLQGGVETGSITEIIGEFKTGKSQLCHTLAVTCQLPVEQSGGEGKCLWVDSEGT 168 > dre:406721 rad51l1, wu:fd07f04, zgc:56581; RAD51-like 1 (S. cerevisiae); K10869 RAD51-like protein 1 Length=373 Score = 55.1 bits (131), Expect = 5e-08, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 D+LL GG+ ++ E+ G + CGKTQ+C L V A LP+ +GG V YIDTE+ Sbjct 87 DRLLHGGLPRGALTEVTGPSGCGKTQLCMMLSVLATLPKSLGGLDSGVIYIDTES 141 > ath:AT2G45280 ATRAD51C; ATP binding / damaged DNA binding / protein binding / recombinase/ single-stranded DNA binding Length=363 Score = 55.1 bits (131), Expect = 5e-08, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D +LGGGI + EI G GKTQI L V Q+PRE GG GK YIDTE + Sbjct 113 DNILGGGISCRDVTEIGGVPGIGKTQIGIQLSVNVQIPRECGGLGGKAIYIDTEGS 168 > sce:YDR004W RAD57; Protein that stimulates strand exchange by stabilizing the binding of Rad51p to single-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; forms heterodimer with Rad55p; K10958 DNA repair protein RAD57 Length=460 Score = 54.7 bits (130), Expect = 6e-08, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 0/55 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 D+LLGGGI + I EIFGE+ GK+Q+ L ++ QL GG GK YI TE Sbjct 108 DELLGGGIFTHGITEIFGESSTGKSQLLMQLALSVQLSEPAGGLGGKCVYITTEG 162 > hsa:5890 RAD51L1, MGC34245, R51H2, RAD51B, REC2, hREC2; RAD51-like 1 (S. cerevisiae); K10869 RAD51-like protein 1 Length=350 Score = 53.9 bits (128), Expect = 1e-07, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 D+ L GG+ S+ EI G CGKTQ C + + A LP MGG G V YIDTE+ Sbjct 91 DEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTES 145 > mmu:19363 Rad51l1, AI553500, R51H2, Rad51b, mREC2; RAD51-like 1 (S. cerevisiae); K10869 RAD51-like protein 1 Length=350 Score = 52.4 bits (124), Expect = 4e-07, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 D+ L GG+ S+ EI G CGKTQ C + V A LP +GG G V YIDTE+ Sbjct 91 DEALHGGVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTES 145 > dre:450081 rad51c, zgc:101596; rad51 homolog C (S. cerevisiae); K10870 RAD51-like protein 2 Length=362 Score = 49.7 bits (117), Expect = 2e-06, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 30/56 (53%), Gaps = 0/56 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEAT 56 D +GGG+ EI G GKTQ+C L V Q+P GG GK YIDTE + Sbjct 94 DDAIGGGVPVGKTTEICGAPGVGKTQLCMQLAVDVQIPVFFGGLGGKALYIDTEGS 149 > xla:379577 xrcc3, MGC69118; X-ray repair complementing defective repair in Chinese hamster cells 3; K10880 DNA-repair protein XRCC3 Length=350 Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D L GGI + I EI GE+ GKTQI LC++ Q P E GG YI TE Sbjct 90 DNFLRGGIPLVGITEIAGESSAGKTQIGLQLCLSVQYPVEYGGLASGAVYICTE 143 > mmu:114714 Rad51c, R51H3, Rad51l2; RAD51 homolog c (S. cerevisiae); K10870 RAD51-like protein 2 Length=366 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D +LGGGI M E+ G GKTQ+C L V Q+P GG G+ +IDTE Sbjct 99 DNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTE 152 > dre:541414 xrcc3, im:7142103, si:dkey-11b8.1, zgc:101608; X-ray repair complementing defective repair in Chinese hamster cells 3; K10880 DNA-repair protein XRCC3 Length=352 Score = 48.1 bits (113), Expect = 6e-06, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D L+ GG+ I E+ GE+ GKTQ C LC++ Q P+E GG YI TE Sbjct 90 DGLMRGGLPLRGITELAGESAAGKTQFCLQLCLSVQYPQEHGGLNSGAVYICTE 143 > ath:AT5G57450 XRCC3; XRCC3; ATP binding / damaged DNA binding / protein binding / single-stranded DNA binding; K10880 DNA-repair protein XRCC3 Length=304 Score = 47.0 bits (110), Expect = 2e-05, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D L GGI S+ EI E+ CGKTQ+C L + QLP GG G Y+ +E Sbjct 29 DGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPISHGGLNGSSLYLHSE 82 > hsa:7517 XRCC3, CMM6; X-ray repair complementing defective repair in Chinese hamster cells 3; K10880 DNA-repair protein XRCC3 Length=346 Score = 45.1 bits (105), Expect = 6e-05, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 D LL GG+ I E+ G + GKTQ+ LC+ Q PR+ GG YI TE Sbjct 90 DALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTE 143 > mmu:74335 Xrcc3, 4432412E01Rik, AI182522, AW537713; X-ray repair complementing defective repair in Chinese hamster cells 3; K10880 DNA-repair protein XRCC3 Length=349 Score = 44.7 bits (104), Expect = 8e-05, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 0/54 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTE 54 DQ LGGG+ I + G + GKTQ+ LC+ Q PR+ GG YI TE Sbjct 90 DQFLGGGLPLEGITGLAGCSSAGKTQLALQLCLAVQFPRQYGGLEAGAVYICTE 143 > ath:AT2G28560 RAD51B; RAD51B; recombinase; K10869 RAD51-like protein 1 Length=370 Score = 43.1 bits (100), Expect = 2e-04, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 0/55 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 D L GGI + E+ G GK+Q C L ++A P GG G+V YID E+ Sbjct 92 DDTLCGGIPFGVLTELVGPPGIGKSQFCMKLALSASFPVAYGGLDGRVIYIDVES 146 > cpv:cgd2_4070 hypothetical protein Length=304 Score = 33.1 bits (74), Expect = 0.22, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 10/63 (15%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPR---------EMGGGCGKVCYI 51 D+ GGI + EI GE GKTQ C TL +T+ L R E+ G VC + Sbjct 46 DKAFNGGIPKRILFEITGEAGTGKTQWCLTL-ITSVLLRNLDFSKVMGELNSDIGIVCVL 104 Query 52 DTE 54 TE Sbjct 105 YTE 107 > mmu:19364 Rad51l3, DKFZp586D0122, R51H3, Rad51d, Trad-d2, Trad-d3, Trad-d4, Trad-d6, Trad-d7; RAD51-like 3 (S. cerevisiae); K10871 RAD51-like protein 3 Length=329 Score = 31.2 bits (69), Expect = 0.72, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDT 53 D+LL G+ + + EI G GKTQ+C LCV A + + V Y+D+ Sbjct 90 DKLLDAGLYTGEVTEIVGGPGSGKTQVC--LCVAANVAHSLQ---QNVLYVDS 137 > dre:404608 MGC77165; zgc:77165; K10871 RAD51-like protein 3 Length=327 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 9/57 (15%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCV--TAQLPREMGGGCGKVCYIDTEA 55 D+LL G+ + I E+ G GKTQ+C ++ V + QL + V YIDT+ Sbjct 90 DKLLDSGLYTGEITELTGSPGSGKTQVCFSVAVNISHQLKQ-------TVVYIDTKG 139 > ath:AT1G07745 RAD51D; RAD51D (ARABIDOPSIS HOMOLOG OF RAD51 D); ATP binding / DNA binding / DNA-dependent ATPase Length=304 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDT 53 D LL GG + E+ G + GKTQ C + G+V Y+DT Sbjct 79 DSLLQGGFREGQLTELVGPSSSGKTQFCMQAAASVA-----ENHLGRVLYLDT 126 > cpv:cgd2_3880 hypothetical protein Length=497 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 0/43 (0%) Query 13 IAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDTEA 55 I I G GK+ + L + LP E+GG KV YIDT++ Sbjct 97 ILGIMGSIGSGKSLLIMHLIAISILPEEIGGHDQKVYYIDTDS 139 > hsa:5892 RAD51L3, R51H3, RAD51D, TRAD; RAD51-like 3 (S. cerevisiae); K10871 RAD51-like protein 3 Length=348 Score = 29.6 bits (65), Expect = 2.1, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDT 53 D+LL G+ + + EI G GKTQ+C LC+ A + G V Y+D+ Sbjct 110 DKLLDAGLYTGEVTEIVGGPGSGKTQVC--LCMAANVAH---GLQQNVLYVDS 157 > xla:444788 rad51l3, MGC82048; RAD51-like 3; K10871 RAD51-like protein 3 Length=324 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVCYIDT 53 D LL G+ + + EI G GKTQ+C ++ V + V Y+DT Sbjct 90 DILLDSGLYTGEVTEIAGAAGSGKTQMCQSIAVNVAYSLKQ-----TVLYVDT 137 > cpv:cgd4_2050 hypothetical protein Length=133 Score = 28.1 bits (61), Expect = 7.8, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 23 GKTQICHTLCVTAQLPREMGGGCGKVCYI-DTE 54 GKT +C L + Q+P+ +GG YI D+E Sbjct 21 GKTLLCKILALNIQIPKSIGGPGLNAIYIGDSE 53 > eco:b2699 recA, ECK2694, JW2669, lexB, recH, rnmB, srf, tif, umuB, umuR, zab; DNA strand exchange and recombination protein with protease and nuclease activity; K03553 recombination protein RecA Length=353 Score = 27.7 bits (60), Expect = 8.4, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Query 3 LLGGGIESMSIAEIFGENRCGKTQICHTLCVTAQLPREMGGGCGKVC-YIDTE 54 L GG+ I EI+G GKT + TL V A RE GK C +ID E Sbjct 52 LGAGGLPMGRIVEIYGPESSGKTTL--TLQVIAAAQRE-----GKTCAFIDAE 97 > tpv:TP04_0453 hypothetical protein Length=286 Score = 27.7 bits (60), Expect = 8.6, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 1 DQLLGGGIESMSIAEIFGENRCGKTQICHTL 31 DQ L GG+ + EI+G + GKTQ +L Sbjct 36 DQALNGGLLLGKVCEIYGPSGSGKTQFALSL 66 Lambda K H 0.321 0.140 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2005549208 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40