bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2810_orf1 Length=74 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_113060 eukaryotic translation initiation factor 2B,... 109 2e-24 cpv:cgd5_1600 translation initiation factor if-2B beta; eIF-2 ... 51.2 8e-07 pfa:PFL2430c eukaryotictranslation initiation factor 2b, subun... 50.1 2e-06 ath:AT3G07300 eukaryotic translation initiation factor 2B fami... 48.9 4e-06 mmu:217715 Eif2b2, AA409345, C85417, EIF-2Bbeta, EIF2B; eukary... 43.9 1e-04 xla:379960 eif2b2, MGC53907; eukaryotic translation initiation... 43.9 1e-04 hsa:8892 EIF2B2, EIF-2Bbeta, EIF2B; eukaryotic translation ini... 43.1 2e-04 sce:YLR291C GCD7; Beta subunit of the translation initiation f... 42.7 3e-04 dre:405839 eif2b2, MGC77512, zgc:77512; eukaryotic translation... 41.2 9e-04 mmu:22390 Wee1; WEE 1 homolog 1 (S. pombe) (EC:2.7.10.2); K066... 29.3 3.2 > tgo:TGME49_113060 eukaryotic translation initiation factor 2B, putative ; K03754 translation initiation factor eIF-2B subunit beta Length=693 Score = 109 bits (273), Expect = 2e-24, Method: Composition-based stats. Identities = 47/72 (65%), Positives = 63/72 (87%), Gaps = 0/72 (0%) Query 2 WTAPFVEAFLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLIC 61 WTAPF+EA + QLRRRE+RGS AA+RTAE L+R+VD YPW+TT EL+DVV+++GRRLI Sbjct 249 WTAPFIEALILQLRRRELRGSHQAARRTAEVLRRLVDVYPWQTTHELIDVVKHVGRRLIR 308 Query 62 AAPLDLLVANIV 73 A+P++ LVAN++ Sbjct 309 ASPMEFLVANVL 320 > cpv:cgd5_1600 translation initiation factor if-2B beta; eIF-2 ; K03754 translation initiation factor eIF-2B subunit beta Length=362 Score = 51.2 bits (121), Expect = 8e-07, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 0/56 (0%) Query 10 FLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLICAAPL 65 ++ LRRR++ GS+ K+T E L+++VD Y WK EL+ ++ IG + PL Sbjct 38 LIELLRRRQLIGSQAQGKKTLEVLRQIVDKYSWKNVNELISNIKEIGSEVASIDPL 93 > pfa:PFL2430c eukaryotictranslation initiation factor 2b, subunit 2, putative; K03754 translation initiation factor eIF-2B subunit beta Length=679 Score = 50.1 bits (118), Expect = 2e-06, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 0/72 (0%) Query 2 WTAPFVEAFLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLIC 61 W V+ + + I GS K+ AE LK++V+ Y WK +L+++++Y+G+++I Sbjct 257 WLNGIVDLLKRGFKNGNICGSNSVGKKIAEVLKKIVEIYQWKNVFDLIEIIKYLGKQIIK 316 Query 62 AAPLDLLVANIV 73 + ++ NI+ Sbjct 317 NNKMFFVIPNII 328 > ath:AT3G07300 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein; K03754 translation initiation factor eIF-2B subunit beta Length=407 Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Query 7 VEAFLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQE---LVDVVRYIGRRLICAA 63 V F+ +LR+R+I GS+ AK T E L+ V+ + L+D V+ +G +LI A Sbjct 8 VVEFVNKLRKRKIEGSQATAKYTVELLRSVISHQRVPHANQAAALIDAVKAVGEQLIAAN 67 Query 64 PLDLLVANIV 73 P++L V N+V Sbjct 68 PVELAVGNVV 77 > mmu:217715 Eif2b2, AA409345, C85417, EIF-2Bbeta, EIF2B; eukaryotic translation initiation factor 2B, subunit 2 beta; K03754 translation initiation factor eIF-2B subunit beta Length=351 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Query 7 VEAFLQQLRRRE-IRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLICAAPL 65 +E F++ L+R R S A+ T L+R++ + W +L+D++R GRR+ A P Sbjct 15 IEGFVETLKRGGGQRSSEDMARETLGLLRRLITDHHWNNAGDLMDLIRREGRRMTAAQPS 74 Query 66 DLLVANIV 73 + V N+V Sbjct 75 ETTVGNMV 82 > xla:379960 eif2b2, MGC53907; eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa; K03754 translation initiation factor eIF-2B subunit beta Length=305 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Query 7 VEAFLQQLRRREIR-GSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLICAAPL 65 +EAF+ +L+R R S A+ T L+R++ W EL++++R GRR+ A P Sbjct 15 IEAFVAELKRGGGRPSSDETARETVGLLRRIIAQARWGNAGELMEIIRREGRRMTAAQPS 74 Query 66 DLLVANIV 73 + V N+V Sbjct 75 ETTVGNMV 82 > hsa:8892 EIF2B2, EIF-2Bbeta, EIF2B; eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa; K03754 translation initiation factor eIF-2B subunit beta Length=351 Score = 43.1 bits (100), Expect = 2e-04, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Query 7 VEAFLQQLRRRE-IRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLICAAPL 65 +E+F++ L+R R S A+ T L++++ + W EL++++R GRR+ A P Sbjct 15 IESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPS 74 Query 66 DLLVANIV 73 + V N+V Sbjct 75 ETTVGNMV 82 > sce:YLR291C GCD7; Beta subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression; K03754 translation initiation factor eIF-2B subunit beta Length=381 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 0/67 (0%) Query 7 VEAFLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLICAAPLD 66 ++ F+ +L+RR+++GS A T + L R + A W +L++ +R +G L A P Sbjct 22 IDTFVAKLKRRQVQGSYAIALETLQLLMRFISAARWNHVNDLIEQIRDLGNSLEKAHPTA 81 Query 67 LLVANIV 73 N++ Sbjct 82 FSCGNVI 88 > dre:405839 eif2b2, MGC77512, zgc:77512; eukaryotic translation initiation factor 2B, subunit 2 beta; K03754 translation initiation factor eIF-2B subunit beta Length=355 Score = 41.2 bits (95), Expect = 9e-04, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 5/72 (6%) Query 7 VEAFLQQLRRREIRGSRM-----AAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRLIC 61 +E+FL +L+R + A+ T+ L+R+ W + EL++++R GRR+ Sbjct 14 IESFLSELKRCGSGSGSLRGSVETARETSSLLRRITAQARWSSAGELMEIIRKEGRRMTA 73 Query 62 AAPLDLLVANIV 73 A P + V N++ Sbjct 74 AQPSETTVGNMI 85 > mmu:22390 Wee1; WEE 1 homolog 1 (S. pombe) (EC:2.7.10.2); K06632 wee1-like protein kinase [EC:2.7.11.1] Length=646 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 0/52 (0%) Query 8 EAFLQQLRRREIRGSRMAAKRTAETLKRVVDAYPWKTTQELVDVVRYIGRRL 59 E F L ++E++ ++MAAK AE D ++T + R IG+++ Sbjct 586 EKFKNSLLQKELKKAQMAAKVAAEERALFTDRMATRSTTQSNRTSRLIGKKM 637 Lambda K H 0.327 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2007182052 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40