bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2748_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing... 149 1e-36 cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domain... 97.4 1e-20 mmu:224023 Klhl22, 2610318I18Rik, Kelchl; kelch-like 22 (Droso... 33.9 0.12 hsa:84861 KLHL22, KELCHL; kelch-like 22 (Drosophila); K10459 k... 33.1 0.20 pfa:PF11_0540a conserved Plasmodium protein 29.3 2.8 eco:b3057 bacA, ECK3047, JW3029, uppP; undecaprenyl pyrophosph... 28.9 4.4 ath:AT1G21065 hypothetical protein 28.5 5.2 cel:T05F1.6 hsr-9; hypothetical protein 27.7 9.8 > tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing protein (EC:3.4.14.11); K06978 Length=1177 Score = 149 bits (377), Expect = 1e-36, Method: Composition-based stats. Identities = 65/117 (55%), Positives = 84/117 (71%), Gaps = 0/117 (0%) Query 1 GKVAGGGLSYDGMLGLSLASRGGIDTIISLFTPINIMNELVAPGGLLCYSFLHDYTQLTN 60 GKV GGG+SYDGM GLS A+ GG+D ++SLFTP+++ +L+ PGG +C SFL DY +T Sbjct 325 GKVGGGGISYDGMTGLSTAAAGGVDAVLSLFTPMHVFGDLLVPGGFVCSSFLKDYAGMTY 384 Query 61 NFEQNGSPWRHMLNSPLQFPFHVLLGFLFSFGGASAVLGYEEDLHKAINSHKNNWRM 117 FE+ G+P HMLN+P ++P HVLLGF +FG S V G E DL +AI HK NW M Sbjct 385 GFERAGTPLAHMLNNPWKYPLHVLLGFSVAFGPGSGVFGREGDLARAIMGHKKNWDM 441 > cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domains ; K06978 Length=1103 Score = 97.4 bits (241), Expect = 1e-20, Method: Composition-based stats. Identities = 47/134 (35%), Positives = 70/134 (52%), Gaps = 17/134 (12%) Query 1 GKVAGGGLSYDGMLGLSLAS-----------------RGGIDTIISLFTPINIMNELVAP 43 GKV GG+SYDGM + A+ +D + +L +P+N++ EL+ P Sbjct 518 GKVGVGGISYDGMAAIKTAALSGNNESESSSEGFRSDNNLVDAVFALSSPMNVIKELIEP 577 Query 44 GGLLCYSFLHDYTQLTNNFEQNGSPWRHMLNSPLQFPFHVLLGFLFSFGGASAVLGYEED 103 GGL+C + DY +T +FEQ GSP H L + +PF +++ FL G S V GY Sbjct 578 GGLICKPLVEDYYSITYSFEQYGSPLLHFLKTVAYYPFKLVVAFLLVIGNVSPVQGYSSI 637 Query 104 LHKAINSHKNNWRM 117 +A+ H+ NW M Sbjct 638 KKQALEMHQKNWDM 651 > mmu:224023 Klhl22, 2610318I18Rik, Kelchl; kelch-like 22 (Drosophila); K10459 kelch-like protein 22 Length=634 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Query 54 DYTQLTNNFEQNGSPWRHMLNSPLQFPFH---VLLGFLFSFGGASAVLGYEEDLHK 106 DY + T+ ++ + W + + P++ +H LL LF GG++ GY D+H+ Sbjct 458 DYLKETHCYDPGSNTWHTLADGPVRRAWHGMAALLDKLFVIGGSNNDAGYRRDVHQ 513 > hsa:84861 KLHL22, KELCHL; kelch-like 22 (Drosophila); K10459 kelch-like protein 22 Length=634 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Query 54 DYTQLTNNFEQNGSPWRHMLNSPLQFPFH---VLLGFLFSFGGASAVLGYEEDLHK 106 DY + T+ ++ + W + + P++ +H LL L+ GG++ GY D+H+ Sbjct 458 DYLKETHCYDPGSNTWHTLADGPVRRAWHGMATLLNKLYVIGGSNNDAGYRRDVHQ 513 > pfa:PF11_0540a conserved Plasmodium protein Length=1467 Score = 29.3 bits (64), Expect = 2.8, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query 48 CYSFLHDYTQLTNNFEQNGSP--WRHMLNSPLQFPFHVLLGFLFSF 91 CY FL+ Y + N+ N SP W + S + +L+ F +S+ Sbjct 330 CYLFLNTYNENLNDITMNTSPSRWNKIKLSSWGYKGSLLINFFYSY 375 > eco:b3057 bacA, ECK3047, JW3029, uppP; undecaprenyl pyrophosphate phosphatase (EC:3.6.1.27); K06153 undecaprenyl-diphosphatase [EC:3.6.1.27] Length=273 Score = 28.9 bits (63), Expect = 4.4, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 25 DTIISLFTPINIMNELVAPGGLL 47 DTI SLF PIN+M LV G LL Sbjct 111 DTIKSLFNPINVMYALVVGGLLL 133 > ath:AT1G21065 hypothetical protein Length=217 Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 0/21 (0%) Query 63 EQNGSPWRHMLNSPLQFPFHV 83 E N +PWRH + P P H+ Sbjct 150 EGNSAPWRHTMEGPDDMPAHI 170 > cel:T05F1.6 hsr-9; hypothetical protein Length=1165 Score = 27.7 bits (60), Expect = 9.8, Method: Composition-based stats. Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 8/73 (10%) Query 16 LSLASRGGIDTIISLFTPINIMNELVAPGGLLCYSFLHDYTQLTNNFEQNGSPWRHMLNS 75 L+ A+R ++ S+F N+MN + GG++ T+ N+F++ S + +L S Sbjct 935 LTSANRSNSASVPSMFKKKNLMNFITQNGGIV--------TEQLNSFQERYSNYEPLLIS 986 Query 76 PLQFPFHVLLGFL 88 + H L L Sbjct 987 DTYYRTHKYLAAL 999 Lambda K H 0.322 0.141 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2032807080 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40