bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2723_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_038240 bystin, putative (EC:3.4.24.61); K14797 esse... 78.6 5e-15 tgo:TGME49_028070 hypothetical protein 27.7 8.3 > tgo:TGME49_038240 bystin, putative (EC:3.4.24.61); K14797 essential nuclear protein 1 Length=558 Score = 78.6 bits (192), Expect = 5e-15, Method: Composition-based stats. Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 17/128 (13%) Query 3 MLPPKLGKKLLKLVEEQQ---------KDEGIGEGSDEDGNESGVEEEADEDGFVVLDCE 53 ++P +L KK+L+LVEEQQ D G E ED + E+ D +GFVV+D E Sbjct 148 VVPRRLSKKILRLVEEQQHHRSENGPDADSG-SELDSEDVDRDSGGEDVDSEGFVVIDGE 206 Query 54 EDEED---VAFYKQRAGEIPRGTINLADLVMEQLRKQSENAAGKEANEEPE---SNLSPK 107 DEED V +QR G LAD ++E+LR++ E + A E PE S L PK Sbjct 207 ADEEDELYVQRVQQRQGTAAAAP-TLADFILEKLRQKEERESSGAAAEAPEEDCSALPPK 265 Query 108 VIEVYTAM 115 V+EVYTAM Sbjct 266 VVEVYTAM 273 > tgo:TGME49_028070 hypothetical protein Length=3891 Score = 27.7 bits (60), Expect = 8.3, Method: Composition-based stats. Identities = 25/87 (28%), Positives = 36/87 (41%), Gaps = 3/87 (3%) Query 25 IGEGSDEDGNESGVEEEADEDGFVVLDCEEDEEDVAFYKQRAGEIPRGTINLADLVMEQL 84 +G D+D ++ EE+ D L E V + R + RG LA L M+ L Sbjct 2657 LGVDGDDDDEKARDEEQEQGDRAASLAARIVEGGVTTHLLR---LTRGVPRLASLRMQSL 2713 Query 85 RKQSENAAGKEANEEPESNLSPKVIEV 111 R Q + EE S +SP + V Sbjct 2714 RMQPNRCSSTPQREEGTSRVSPNLDRV 2740 Lambda K H 0.304 0.130 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2042676840 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40