bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2714_orf1 Length=70 Score E Sequences producing significant alignments: (Bits) Value ath:AT1G62750 SCO1; SCO1 (SNOWY COTYLEDON 1); ATP binding / tr... 96.3 2e-20 eco:b3340 fusA, ECK3327, far, fus, JW3302; protein chain elong... 89.4 3e-18 tgo:TGME49_023970 elongation factor G, putative (EC:3.1.6.1) 70.5 1e-12 tgo:TGME49_060170 elongation factor G, putative (EC:2.7.7.4); ... 63.2 2e-10 tpv:TP01_0278 translation elongation factor G 2; K02355 elonga... 61.6 6e-10 sce:YJL102W MEF2; Mef2p; K02355 elongation factor G 56.6 2e-08 ath:AT1G45332 mitochondrial elongation factor, putative; K0235... 55.1 6e-08 ath:AT2G45030 mitochondrial elongation factor, putative; K0235... 55.1 6e-08 mmu:28030 Gfm1, AW545374, D3Wsu133e, Gfm; G elongation factor,... 52.4 4e-07 sce:YLR069C MEF1; Mef1p; K02355 elongation factor G 51.6 6e-07 pfa:PFL1590c elongation factor G, putative; K02355 elongation ... 51.2 8e-07 xla:100101315 gfm1, EF-Gmt, coxpd1, efg, efg1, efgm, egf1, gfm... 49.3 3e-06 dre:558184 gfm2, si:dkey-35i22.3, zgc:153835; G elongation fac... 49.3 3e-06 dre:100329815 Ribosome-releasing factor 2, mitochondrial-like;... 49.3 3e-06 dre:100330620 Ribosome-releasing factor 2, mitochondrial-like;... 49.3 3e-06 cel:F29C12.4 hypothetical protein; K02355 elongation factor G 48.1 7e-06 bbo:BBOV_IV004710 23.m06266; translation elongation factor G (... 47.4 1e-05 hsa:85476 GFM1, COXPD1, EFG, EFG1, EFGM, EGF1, FLJ12662, FLJ13... 47.0 2e-05 mmu:320806 Gfm2, 6530419G12Rik, A930009M04Rik, EFG2, MST027; G... 45.1 6e-05 bbo:BBOV_III000360 17.m07056; translation elongation factor G;... 45.1 6e-05 hsa:84340 GFM2, EF-G2mt, EFG2, MRRF2, MST027, RRF2, RRF2mt, hE... 42.7 3e-04 pfa:PFF0115c elongation factor G, putative; K02355 elongation ... 42.0 5e-04 dre:561840 gfm1, zgc:154041; G elongation factor, mitochondria... 40.8 0.001 tpv:TP03_0816 elongation factor G; K02355 elongation factor G 40.8 0.001 cel:Y119D3B.14 hypothetical protein; K02355 elongation factor G 34.7 0.068 tpv:TP01_1045 hypothetical protein; K03596 GTP-binding protein... 31.6 0.67 tgo:TGME49_018790 elongation factor Tu GTP-binding domain-cont... 31.2 0.95 ath:AT5G08650 GTP-binding protein LepA, putative; K03596 GTP-b... 29.6 2.1 tgo:TGME49_064210 hypothetical protein 29.3 3.1 > ath:AT1G62750 SCO1; SCO1 (SNOWY COTYLEDON 1); ATP binding / translation elongation factor/ translation factor, nucleic acid binding; K02355 elongation factor G Length=783 Score = 96.3 bits (238), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 DD +P A LAFKI +DPFVG LTF+RVY+G + +GSYVLNA+K +ER+GRLL+MHANSR Sbjct 391 DDDEPFAGLAFKIMSDPFVGSLTFVRVYSGKISAGSYVLNANKGKKERIGRLLEMHANSR 450 > eco:b3340 fusA, ECK3327, far, fus, JW3302; protein chain elongation factor EF-G, GTP-binding; K02355 elongation factor G Length=704 Score = 89.4 bits (220), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 41/64 (64%), Positives = 49/64 (76%), Gaps = 0/64 (0%) Query 7 ELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMH 66 E A D +P +ALAFKIATDPFVG LTF RVY+G + SG VLN+ K +RER GR++QMH Sbjct 308 ERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERFGRIVQMH 367 Query 67 ANSR 70 AN R Sbjct 368 ANKR 371 > tgo:TGME49_023970 elongation factor G, putative (EC:3.1.6.1) Length=750 Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 0/56 (0%) Query 15 PLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 PL+AL FK+ TDPFVG F+RVYTG L GS V+N ER+ RL+ +HAN+R Sbjct 335 PLSALVFKMTTDPFVGVQNFVRVYTGELRPGSVVMNVRTGKEERIQRLVLIHANAR 390 > tgo:TGME49_060170 elongation factor G, putative (EC:2.7.7.4); K02355 elongation factor G Length=877 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Query 1 KTGDEVELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRER-V 59 K +EV L AD KK L ALAFKI P VG+LT++R+Y G L+ G V+N S R + Sbjct 464 KQEEEVPLHADPKKSLVALAFKIQELP-VGQLTYLRLYQGKLKKGDSVVNVSTQKRSSPI 522 Query 60 GRLLQMHAN 68 R+LQMHA+ Sbjct 523 KRILQMHAD 531 > tpv:TP01_0278 translation elongation factor G 2; K02355 elongation factor G Length=803 Score = 61.6 bits (148), Expect = 6e-10, Method: Composition-based stats. Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 0/56 (0%) Query 15 PLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 PLAAL FK++ D VG TFIR+Y GS+++G YV N +RV ++L MH+N R Sbjct 418 PLAALVFKLSFDQQVGNQTFIRIYRGSIKTGDYVYNPRTKKSQRVQKILFMHSNER 473 > sce:YJL102W MEF2; Mef2p; K02355 elongation factor G Length=819 Score = 56.6 bits (135), Expect = 2e-08, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 42/62 (67%), Gaps = 0/62 (0%) Query 8 LMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHA 67 L+ ++K ALAFK+ TDP G+ FIR+Y+G+L SG+ V N++ + ++G+LL HA Sbjct 350 LVNNNKNLCIALAFKVITDPIRGKQIFIRIYSGTLNSGNTVYNSTTGEKFKLGKLLIPHA 409 Query 68 NS 69 + Sbjct 410 GT 411 > ath:AT1G45332 mitochondrial elongation factor, putative; K02355 elongation factor G Length=754 Score = 55.1 bits (131), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Query 4 DEVELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLL 63 + V L PL ALAFK+ F G+LT++RVY G ++ G +++N + R +V RL+ Sbjct 354 ERVTLTGSPDGPLVALAFKLEEGRF-GQLTYLRVYEGVIKKGDFIINVNTGKRIKVPRLV 412 Query 64 QMHAN 68 +MH+N Sbjct 413 RMHSN 417 > ath:AT2G45030 mitochondrial elongation factor, putative; K02355 elongation factor G Length=754 Score = 55.1 bits (131), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Query 4 DEVELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLL 63 + V L PL ALAFK+ F G+LT++RVY G ++ G +++N + R +V RL+ Sbjct 354 ERVTLTGSPDGPLVALAFKLEEGRF-GQLTYLRVYEGVIKKGDFIINVNTGKRIKVPRLV 412 Query 64 QMHAN 68 +MH+N Sbjct 413 RMHSN 417 > mmu:28030 Gfm1, AW545374, D3Wsu133e, Gfm; G elongation factor, mitochondrial 1; K02355 elongation factor G Length=751 Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHAN 68 DD P LAFK+ F G+LT++R Y G L+ GS + N + RV RL++MHA+ Sbjct 348 DDSHPFVGLAFKLEAGRF-GQLTYVRNYQGELKKGSTIYNTRTGKKVRVQRLVRMHAD 404 > sce:YLR069C MEF1; Mef1p; K02355 elongation factor G Length=761 Score = 51.6 bits (122), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query 5 EVELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQ 64 +V L+ ++P LAFK+ + G+LT++RVY G L G+Y+ N + +V RL++ Sbjct 364 KVNLVPAVQQPFVGLAFKLEEGKY-GQLTYVRVYQGRLRKGNYITNVKTGKKVKVARLVR 422 Query 65 MHAN 68 MH++ Sbjct 423 MHSS 426 > pfa:PFL1590c elongation factor G, putative; K02355 elongation factor G Length=803 Score = 51.2 bits (121), Expect = 8e-07, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 0/63 (0%) Query 6 VELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQM 65 ++L+ D+ P+ FKI D G++++ R+Y G ++ + N N +E V ++++M Sbjct 405 IQLLCDNNLPMVGFLFKIQEDNMYGQMSYFRIYQGKIKKKEMITNMMTNKKEIVKKIMKM 464 Query 66 HAN 68 H+N Sbjct 465 HSN 467 > xla:100101315 gfm1, EF-Gmt, coxpd1, efg, efg1, efgm, egf1, gfm; G elongation factor, mitochondrial 1; K02355 elongation factor G Length=748 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHAN 68 D +P LAFK+ F G+LT++RVY G L Y+ N + RV RL+ +HA+ Sbjct 345 DSSQPFVGLAFKLEAGRF-GQLTYVRVYQGMLRKSDYIYNTRTGKKVRVQRLVCLHAD 401 > dre:558184 gfm2, si:dkey-35i22.3, zgc:153835; G elongation factor, mitochondrial 2; K02355 elongation factor G Length=762 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 0/58 (0%) Query 13 KKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 K L ALAFK+ D G L F+R+Y+GS+++ S V N ++N E++ RLL A+ + Sbjct 352 KNDLCALAFKVVHDKQRGPLVFVRIYSGSMKAQSSVHNINRNETEKMSRLLLPFADQQ 409 > dre:100329815 Ribosome-releasing factor 2, mitochondrial-like; K02355 elongation factor G Length=762 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 0/58 (0%) Query 13 KKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 K L ALAFK+ D G L F+R+Y+GS+++ S V N ++N E++ RLL A+ + Sbjct 352 KNDLCALAFKVVHDKQRGPLVFVRIYSGSMKAQSSVHNINRNETEKMSRLLLPFADQQ 409 > dre:100330620 Ribosome-releasing factor 2, mitochondrial-like; K02355 elongation factor G Length=684 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 0/58 (0%) Query 13 KKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 K L ALAFK+ D G L F+R+Y+GS+++ S V N ++N E++ RLL A+ + Sbjct 352 KNDLCALAFKVVHDKQRGPLVFVRIYSGSMKAQSSVHNINRNETEKMSRLLLPFADQQ 409 > cel:F29C12.4 hypothetical protein; K02355 elongation factor G Length=750 Score = 48.1 bits (113), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 5/70 (7%) Query 2 TGDEVELMADDK----KPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRE 57 TGDE ++ K KP LAFK+ + G+LT+ RVY G L G V + + Sbjct 332 TGDEKGIILSPKRNNDKPFVGLAFKLEAGKY-GQLTYFRVYQGQLSKGDTVYASRDGRKV 390 Query 58 RVGRLLQMHA 67 RV RL++MHA Sbjct 391 RVQRLVRMHA 400 > bbo:BBOV_IV004710 23.m06266; translation elongation factor G (EF-G); K02355 elongation factor G Length=817 Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 0/56 (0%) Query 15 PLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 PLA L FKI+ D +G ++R+Y G + G V N +V +LL +H+N R Sbjct 429 PLAGLVFKISHDAQIGTQAYVRIYRGQVSVGDVVYNPRTKKSNKVQKLLFIHSNER 484 > hsa:85476 GFM1, COXPD1, EFG, EFG1, EFGM, EGF1, FLJ12662, FLJ13632, FLJ20773, GFM, hEFG1; G elongation factor, mitochondrial 1; K02355 elongation factor G Length=751 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHAN 68 D+ P LAFK+ F G+LT++R Y G L+ G + N + R+ RL +MHA+ Sbjct 348 DNSHPFVGLAFKLEVGRF-GQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARMHAD 404 > mmu:320806 Gfm2, 6530419G12Rik, A930009M04Rik, EFG2, MST027; G elongation factor, mitochondrial 2; K02355 elongation factor G Length=741 Score = 45.1 bits (105), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 0/48 (0%) Query 16 LAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLL 63 L ALAFK+ D G L F+R+Y+G+L V N ++N ER+ RLL Sbjct 367 LCALAFKVLHDKQRGPLVFLRIYSGTLTPQLAVHNINRNCTERMSRLL 414 > bbo:BBOV_III000360 17.m07056; translation elongation factor G; K02355 elongation factor G Length=741 Score = 45.1 bits (105), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query 7 ELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMH 66 EL K+PL A AFKI P +G+LTF+R+Y G + G + + +L +MH Sbjct 343 ELDGGYKQPLVAYAFKIQDSP-MGQLTFLRLYQGMMRRGQQLYLVEDGKKHSTKKLFKMH 401 Query 67 AN 68 A+ Sbjct 402 AS 403 > hsa:84340 GFM2, EF-G2mt, EFG2, MRRF2, MST027, RRF2, RRF2mt, hEFG2, mEF-G_2; G elongation factor, mitochondrial 2; K02355 elongation factor G Length=779 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 0/51 (0%) Query 13 KKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLL 63 K L ALAFK+ D G L F+R+Y+G+++ + N + N ER+ RLL Sbjct 364 KDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLL 414 > pfa:PFF0115c elongation factor G, putative; K02355 elongation factor G Length=937 Score = 42.0 bits (97), Expect = 5e-04, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 32/58 (55%), Gaps = 0/58 (0%) Query 13 KKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMHANSR 70 K+ + L +KI D +G + ++R+Y G + G ++ N E++ ++ +H++ + Sbjct 505 KRKMVGLIYKIMNDQHLGNINYVRIYEGQINRGEFIYNNRTKKSEKISKIFFIHSSEK 562 > dre:561840 gfm1, zgc:154041; G elongation factor, mitochondrial 1; K02355 elongation factor G Length=745 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNA 51 DD +P LAFK+ F G+LT++RVY G L Y+ N+ Sbjct 342 DDTQPFVGLAFKLEAGRF-GQLTYVRVYQGCLRKTDYIHNS 381 > tpv:TP03_0816 elongation factor G; K02355 elongation factor G Length=805 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Query 4 DEVELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLL 63 +++EL +DK L FKI D ++G+L++IR+Y G L G VL ++ R + +L Sbjct 405 NKIELKPEDKG-LVGYIFKI-VDTYLGQLSYIRIYKGVLRRGLSVLVVEEDKRVTLKKLY 462 Query 64 QMHAN 68 ++H++ Sbjct 463 KVHSD 467 > cel:Y119D3B.14 hypothetical protein; K02355 elongation factor G Length=689 Score = 34.7 bits (78), Expect = 0.068, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 0/62 (0%) Query 7 ELMADDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNSRERVGRLLQMH 66 EL K + I D G+L+++R+YTGSL + S + N S+ + E +L + Sbjct 264 ELTCASKIATISCGSAITHDKRRGQLSYMRIYTGSLHNNSTIFNTSQMTSEGPLKLFTPY 323 Query 67 AN 68 A+ Sbjct 324 AD 325 > tpv:TP01_1045 hypothetical protein; K03596 GTP-binding protein LepA Length=711 Score = 31.6 bits (70), Expect = 0.67, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query 11 DDKKPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYV--LNASKNSR 56 D +KP AL F D + G + +IRV+ GS + G + +NA+ S+ Sbjct 279 DLEKPFRALVFDSFYDSYKGAICYIRVFEGSAKVGDEITLMNANITSK 326 > tgo:TGME49_018790 elongation factor Tu GTP-binding domain-containing protein (EC:2.7.7.4); K02355 elongation factor G Length=1133 Score = 31.2 bits (69), Expect = 0.95, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 18 ALAFKIATDPFVGRLTFIRVYTGSLESGSYVLNASKNS 55 +AFK+ D GR+ F+RV G + + + N++KN Sbjct 548 CVAFKVYPDGKGGRIAFVRVLAGRITPRTSLFNSTKNC 585 > ath:AT5G08650 GTP-binding protein LepA, putative; K03596 GTP-binding protein LepA Length=681 Score = 29.6 bits (65), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 14 KPLAALAFKIATDPFVGRLTFIRVYTGSLESGSYVL 49 KPL AL F DP+ G + + RV G ++ G + Sbjct 270 KPLRALIFDSYYDPYRGVIVYFRVIDGKVKKGDRIF 305 > tgo:TGME49_064210 hypothetical protein Length=1185 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 3 GDEVELMADDKKPLAALAFKIATDPFVGRLTFIRV 37 G+E L +KPL+ LA K + DP R+T R Sbjct 133 GEEKTLSIRKRKPLSELALKDSEDPAAARVTPARC 167 Lambda K H 0.317 0.132 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2024947620 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40