bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2644_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_047240 ubiquitin carboxyl-terminal hydrolase isozym... 66.2 2e-11 cpv:cgd1_1170 ubiquitin C-terminal hydrolase 55.8 4e-08 cel:C08B11.7 ubh-4; UBiquitin C-terminal Hydrolase (family 1) ... 45.1 5e-05 ath:AT1G65650 UCH2; UCH2; ubiquitin thiolesterase/ ubiquitin-s... 41.2 8e-04 ath:AT5G16310 UCH1; UCH1; ubiquitin thiolesterase; K05610 ubiq... 39.7 0.002 xla:733154 uchl5; ubiquitin carboxyl-terminal hydrolase L5 (EC... 36.2 0.025 mmu:56207 Uchl5, 5830413B11Rik, Uch37; ubiquitin carboxyl-term... 35.8 0.034 dre:406357 uchl5, wu:fj17f09, zgc:85615; ubiquitin carboxyl-te... 35.0 0.062 pfa:PF11_0486 MAEBL, putative 33.9 0.12 hsa:51377 UCHL5, CGI-70, INO80R, UCH-L5, UCH37; ubiquitin carb... 33.1 0.20 tpv:TP02_0897 hypothetical protein 32.7 0.26 > tgo:TGME49_047240 ubiquitin carboxyl-terminal hydrolase isozyme L5, putative (EC:3.4.19.12); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=407 Score = 66.2 bits (160), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 0/37 (0%) Query 32 KRAEWDRENARRRHDFTPFVLCALRHLARKGELVKAV 68 KRA W +ENARRRHDF PF+L ++HLARKGELVK+V Sbjct 345 KRARWKKENARRRHDFVPFLLTVIKHLARKGELVKSV 381 > cpv:cgd1_1170 ubiquitin C-terminal hydrolase Length=398 Score = 55.8 bits (133), Expect = 4e-08, Method: Composition-based stats. Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 4/62 (6%) Query 13 QAALSKI--EVLEELKALEQAK--RAEWDRENARRRHDFTPFVLCALRHLARKGELVKAV 68 Q ++KI E+ E L ++ K R W +EN RRRHDF PFVL LRH ++KG L+K + Sbjct 335 QKEITKITHEISENLSIIQNEKYNREIWKKENERRRHDFLPFVLTLLRHASKKGLLMKKL 394 Query 69 RR 70 + Sbjct 395 SQ 396 > cel:C08B11.7 ubh-4; UBiquitin C-terminal Hydrolase (family 1) family member (ubh-4); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=321 Score = 45.1 bits (105), Expect = 5e-05, Method: Composition-based stats. Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 7/74 (9%) Query 2 AEEAKQLEEARQAALSKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARK 61 A E +LEE +I L + A E K + +EN RRRH++TPFV+ ++ LA++ Sbjct 236 ANENNELEE-------QIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKE 288 Query 62 GELVKAVRRATAAA 75 G+LV V A AA Sbjct 289 GKLVGLVDNAYQAA 302 > ath:AT1G65650 UCH2; UCH2; ubiquitin thiolesterase/ ubiquitin-specific protease; K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=330 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 0/64 (0%) Query 17 SKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARKGELVKAVRRATAAAA 76 S IE + +E+ K +W EN RR+H++ PF+ L+ LA K +L + +A Sbjct 267 SGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKAKKQKT 326 Query 77 ATAT 80 ++T Sbjct 327 ESST 330 > ath:AT5G16310 UCH1; UCH1; ubiquitin thiolesterase; K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=334 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 0/46 (0%) Query 19 IEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARKGEL 64 IE + + +E+ K W +EN RR+H++ PF+ L+ LA K +L Sbjct 280 IETVSQKIVMEEEKSKNWKKENMRRKHNYVPFLFNFLKILADKKKL 325 > xla:733154 uchl5; ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=329 Score = 36.2 bits (82), Expect = 0.025, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Query 3 EEAKQLEEARQAALSKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARKG 62 ++ L + Q+ ++K ++L E E+ K + EN RR+H++ PF++ L+ LA Sbjct 251 DQGSTLLSSMQSEIAKYQLLIEE---EKQKMKRYKVENIRRKHNYLPFIMELLKTLAEHQ 307 Query 63 ELVKAVRRA 71 +L+ V +A Sbjct 308 QLIPLVEKA 316 > mmu:56207 Uchl5, 5830413B11Rik, Uch37; ubiquitin carboxyl-terminal esterase L5 (EC:3.4.19.12); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=328 Score = 35.8 bits (81), Expect = 0.034, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 39 ENARRRHDFTPFVLCALRHLARKGELVKAVRRA 71 EN RR+H++ PF++ L+ LA +L+ V +A Sbjct 283 ENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA 315 > dre:406357 uchl5, wu:fj17f09, zgc:85615; ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=329 Score = 35.0 bits (79), Expect = 0.062, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Query 13 QAALSKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARKGELVKAVRRAT 72 Q+ ++K ++L E E K + EN RR+H++ PF++ L+ LA +L+ V +A Sbjct 261 QSEIAKYQLLIEE---ENQKLKRYKVENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAK 317 Query 73 AAAAATATAAA 83 +A A Sbjct 318 EKQSAKKIQEA 328 > pfa:PF11_0486 MAEBL, putative Length=2055 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 12/83 (14%) Query 2 AEEAKQLEEARQAALSKIEVLEELKALEQAKRAEWDR--ENAR-----RRHDFTPFVLCA 54 AE+A+++EEAR+A ++ +EE + E A+R E R E+AR RR + + A Sbjct 1108 AEDARRIEEARRAEDAR--RIEEARRAEDARRVEIARRVEDARRIEISRRAEDAKRIEAA 1165 Query 55 LRHL-ARKGELVKA--VRRATAA 74 R + R+ EL KA RR AA Sbjct 1166 RRAIEVRRAELRKAEDARRIEAA 1188 > hsa:51377 UCHL5, CGI-70, INO80R, UCH-L5, UCH37; ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12); K05610 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12] Length=328 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Query 3 EEAKQLEEARQAALSKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARKG 62 ++ + A Q+ ++K ++L E + +++ KR + EN RR+H++ PF++ L+ LA Sbjct 250 DQGNSMLSAIQSEVAKNQMLIE-EEVQKLKR--YKIENIRRKHNYLPFIMELLKTLAEHQ 306 Query 63 ELVKAVRRA 71 +L+ V +A Sbjct 307 QLIPLVEKA 315 > tpv:TP02_0897 hypothetical protein Length=1499 Score = 32.7 bits (73), Expect = 0.26, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Query 4 EAKQLEEARQAALSKIEVLEELKALEQAKRAEWDRENARRRHDFTPFVLCALRHLARK 61 E +L+ R+ AL +E + E+ KR+ +DRE+ R+ F F L LA + Sbjct 1215 EVDRLQTLREQALKIVETFVQ----EEVKRSNYDRESIRKLKQFFDFQTLVLSTLAER 1268 Lambda K H 0.313 0.122 0.325 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069995292 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40