bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2603_orf1 Length=87 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_028000 splicing factor 3A subunit 2, putative ; K12... 145 2e-35 cel:F11A10.2 hypothetical protein; K12826 splicing factor 3A s... 127 1e-29 mmu:20222 Sf3a2, 66kDa, AW047242, PRP11, SFA66, Sap62; splicin... 126 2e-29 hsa:8175 SF3A2, PRP11, PRPF11, SAP62, SF3a66; splicing factor ... 125 2e-29 xla:100101277 hypothetical protein LOC100101277; K12826 splici... 121 6e-28 dre:394018 sf3a2, MGC56097, zgc:56097, zgc:77448; splicing fac... 120 1e-27 xla:379832 sf3a2, MGC52805; splicing factor 3a, subunit 2, 66k... 120 1e-27 tpv:TP02_0636 splicing factor 3A subunit 2; K12826 splicing fa... 119 3e-27 ath:AT2G32600 hydroxyproline-rich glycoprotein family protein;... 112 4e-25 bbo:BBOV_II006710 18.m06549; splicing factor 3a, subunit 2; K1... 110 1e-24 pfa:PFF0970w splicing factor 3a subunit, putative; K12826 spli... 107 1e-23 cpv:cgd6_2830 splicing factor 3a 66kD; N-terminus C2H2 domain ... 100 8e-22 sce:YDL043C PRP11, RNA11; Prp11p; K12826 splicing factor 3A su... 45.1 6e-05 tpv:TP04_0385 hypothetical protein; K12848 U4/U6.U5 tri-snRNP ... 35.4 0.043 ath:AT5G61190 zinc finger protein-related 35.0 0.060 hsa:91603 ZNF830, CCDC16, MGC20398, OMCG1, SEL13; zinc finger ... 33.9 0.13 mmu:66983 Zfp830, 2410003C20Rik, AV301118, AW048207, Ccdc16, O... 33.1 0.22 hsa:79842 ZBTB3, FLJ23392; zinc finger and BTB domain containi... 32.0 0.49 bbo:BBOV_II002560 18.m06206; hypothetical protein; K12848 U4/U... 32.0 0.52 dre:324476 zmat2, fc30d10, flj31121, wu:fc30d10; zinc finger, ... 31.6 0.67 mmu:66492 Zmat2, 2610510D14Rik, 2900082I05Rik; zinc finger, ma... 31.6 0.70 hsa:153527 ZMAT2, FLJ31121, Snu23, hSNU23; zinc finger, matrin... 31.6 0.70 mmu:105835 Sgsm3, 1810012I01Rik, AI428557, BB175482, Cip85, R7... 31.2 0.94 xla:495824 zmat2, snu23; zinc finger, matrin-type 2; K12848 U4... 30.8 0.96 hsa:27352 SGSM3, DKFZp761D051, MAP, RUSC3, RUTBC3; small G pro... 30.8 1.2 ath:AT3G05760 nucleic acid binding / zinc ion binding; K12848 ... 30.4 1.4 dre:791686 cadherin 1, type 1 preproprotein-like 30.4 1.5 hsa:64852 TUT1, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC14... 30.0 1.9 ath:AT2G19380 RNA recognition motif (RRM)-containing protein 30.0 2.0 hsa:23567 ZNF346, DKFZp547M223, JAZ, Zfp346; zinc finger prote... 29.6 2.3 mmu:75291 Zbtb3, 4930563M09Rik; zinc finger and BTB domain con... 29.6 2.5 tgo:TGME49_075310 hypothetical protein 29.6 2.6 ath:AT1G06490 ATGSL07 (glucan synthase-like 7); 1,3-beta-gluca... 29.6 2.6 xla:380471 znf346, DsRBP-ZFa, MGC52555, ZFa, jaz; zinc finger ... 29.3 3.4 dre:394174 pik3cd, MGC63473, zgc:63473; phosphoinositide-3-kin... 28.9 3.9 pfa:PFL2075c conserved Plasmodium protein; K12848 U4/U6.U5 tri... 28.9 4.1 mmu:26919 Zfp346, Jaz, Znf346; zinc finger protein 346 28.9 dre:560756 znf346, MGC158750, im:7136406, wu:fc21c04, zgc:1587... 28.9 4.4 pfa:PF14_0612 conserved Plasmodium protein, unknown function; ... 28.5 4.8 cel:ZK686.4 hypothetical protein; K12848 U4/U6.U5 tri-snRNP co... 28.5 4.8 cel:Y95B8A.7 hypothetical protein 28.5 5.8 mmu:244891 Scaper, C430017I08, D530014O03Rik, Zfp291; S phase ... 28.5 6.0 mmu:320158 Zmat4, 9630048M01Rik, MGC90808; zinc finger, matrin... 28.1 7.4 xla:378688 trove2, ssa2, ssa2-A; TROVE domain family, member 2... 28.1 7.4 xla:399224 zfr; zinc finger RNA binding protein; K13203 zinc f... 27.7 8.1 dre:321659 zfr, hnrpa1, wu:fb25b08, zgc:66235, zgc:66403; zinc... 27.7 8.6 mmu:22763 Zfr, C920030H05Rik, MGC176100; zinc finger RNA bindi... 27.7 8.8 hsa:51663 ZFR, FLJ41312, ZFR1; zinc finger RNA binding protein... 27.7 8.8 dre:100144551 scaper; S phase cyclin A-associated protein in t... 27.7 9.0 dre:567465 zfr2, MGC174987, si:ch211-63j24.3, wu:fb99a09, zfr;... 27.7 9.6 > tgo:TGME49_028000 splicing factor 3A subunit 2, putative ; K12826 splicing factor 3A subunit 2 Length=242 Score = 145 bits (367), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E NLERKERLRRLALET+DLNKDPYFM+NHLG FECRLCLTLH NEGSYL+HTQG+KHQT Sbjct 24 EWNLERKERLRRLALETVDLNKDPYFMKNHLGHFECRLCLTLHVNEGSYLAHTQGRKHQT 83 Query 61 NLSRRLAKEKADAVVAPMPLK 81 NL+RR KEKA++ VAP+P K Sbjct 84 NLARRKEKEKAESAVAPVPAK 104 > cel:F11A10.2 hypothetical protein; K12826 splicing factor 3A subunit 2 Length=222 Score = 127 bits (318), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 0/81 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 + ++R+ERLR+LALETIDL KDPYFMRNH+G +EC+LCLTLH NEGSYL+HTQGKKHQ Sbjct 21 DAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCLTLHNNEGSYLAHTQGKKHQA 80 Query 61 NLSRRLAKEKADAVVAPMPLK 81 NL+RR AKE+++ P P K Sbjct 81 NLARRAAKEQSEQPFLPAPQK 101 > mmu:20222 Sf3a2, 66kDa, AW047242, PRP11, SFA66, Sap62; splicing factor 3a, subunit 2; K12826 splicing factor 3A subunit 2 Length=485 Score = 126 bits (316), Expect = 2e-29, Method: Composition-based stats. Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E N +R+ERLR+LALETID+NKDPYFM+NHLG +EC+LCLTLH NEGSYL+HTQGKKHQT Sbjct 21 ESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT 80 Query 61 NLSRRLAKEKADAVVAPMP 79 NL+RR AKE +A P P Sbjct 81 NLARRAAKEAKEAPAQPAP 99 > hsa:8175 SF3A2, PRP11, PRPF11, SAP62, SF3a66; splicing factor 3a, subunit 2, 66kDa; K12826 splicing factor 3A subunit 2 Length=464 Score = 125 bits (315), Expect = 2e-29, Method: Composition-based stats. Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E N +R+ERLR+LALETID+NKDPYFM+NHLG +EC+LCLTLH NEGSYL+HTQGKKHQT Sbjct 21 ESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT 80 Query 61 NLSRRLAKEKADAVVAPMP 79 NL+RR AKE +A P P Sbjct 81 NLARRAAKEAKEAPAQPAP 99 > xla:100101277 hypothetical protein LOC100101277; K12826 splicing factor 3A subunit 2 Length=405 Score = 121 bits (303), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E N +R+ERLR+LALETID+NKDPYFM+NHLG +EC+LCLTLH NEGSYL+HTQGKKHQT Sbjct 21 ESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT 80 Query 61 NLSRRLAKEKADAVVAPMP 79 NL+RR AKE +A P P Sbjct 81 NLARRAAKEAKEAPAQPAP 99 > dre:394018 sf3a2, MGC56097, zgc:56097, zgc:77448; splicing factor 3a, subunit 2; K12826 splicing factor 3A subunit 2 Length=278 Score = 120 bits (300), Expect = 1e-27, Method: Composition-based stats. Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E N +R+ERLR+LALETID+NKDPYFM+NHLG +EC+LCLTLH NEGSYL+HTQGKKHQ+ Sbjct 21 ESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQS 80 Query 61 NLSRRLAKEKADAVVAPMP 79 NL+RR AKE +A P P Sbjct 81 NLARRAAKEAKEAPAQPAP 99 > xla:379832 sf3a2, MGC52805; splicing factor 3a, subunit 2, 66kDa; K12826 splicing factor 3A subunit 2 Length=405 Score = 120 bits (300), Expect = 1e-27, Method: Composition-based stats. Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 E N +R+ERLR+LALETID+NKDPYFM+NHLG +EC+LCLTLH NEGSYL+HTQGKKHQT Sbjct 21 ESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQT 80 Query 61 NLSRRLAKEKADAVVAPMP 79 NL+RR AKE +A P P Sbjct 81 NLARRAAKEAKEAPAQPAP 99 > tpv:TP02_0636 splicing factor 3A subunit 2; K12826 splicing factor 3A subunit 2 Length=252 Score = 119 bits (298), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 53/86 (61%), Positives = 66/86 (76%), Gaps = 0/86 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 +V ++ERLR+LALET DLNKDPYF +NH+G ECRLCLT+HT E SYLSHTQG+KHQ Sbjct 22 DVAAHQRERLRKLALETFDLNKDPYFSKNHMGHVECRLCLTVHTTESSYLSHTQGRKHQM 81 Query 61 NLSRRLAKEKADAVVAPMPLKRCYCF 86 NL+RR AKE+ DA + P+ + F Sbjct 82 NLARRAAKEQKDAFMTIAPISKTRAF 107 > ath:AT2G32600 hydroxyproline-rich glycoprotein family protein; K12826 splicing factor 3A subunit 2 Length=277 Score = 112 bits (279), Expect = 4e-25, Method: Composition-based stats. Identities = 48/66 (72%), Positives = 56/66 (84%), Gaps = 0/66 (0%) Query 17 TIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVA 76 TIDL KDPYFMRNHLG +EC+LCLTLH NEG+YL+HTQGK+HQTNL++R A+E DA Sbjct 35 TIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPTK 94 Query 77 PMPLKR 82 P PLKR Sbjct 95 PQPLKR 100 > bbo:BBOV_II006710 18.m06549; splicing factor 3a, subunit 2; K12826 splicing factor 3A subunit 2 Length=238 Score = 110 bits (275), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%) Query 7 KERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRL 66 ++RLRRLALET DL KDPY +NHLGQ ECRLCLT+H ++GSYLSHTQG+KHQ NL+RR Sbjct 27 RDRLRRLALETFDLGKDPYLQKNHLGQLECRLCLTIHASDGSYLSHTQGRKHQMNLARRA 86 Query 67 AKEKADAVVAPMP 79 AKE+ + P+P Sbjct 87 AKEERNNFHQPIP 99 > pfa:PFF0970w splicing factor 3a subunit, putative; K12826 splicing factor 3A subunit 2 Length=233 Score = 107 bits (266), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 47/75 (62%), Positives = 61/75 (81%), Gaps = 0/75 (0%) Query 1 EVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 ++N ER+ERL++LALE ID+ KDPY ++N++G FEC+LCLTLH NE SYL HTQGKKHQ Sbjct 21 DINQERRERLKQLALENIDITKDPYILKNNVGMFECKLCLTLHNNESSYLCHTQGKKHQM 80 Query 61 NLSRRLAKEKADAVV 75 NL++RL KEK + Sbjct 81 NLAQRLLKEKNEMTT 95 > cpv:cgd6_2830 splicing factor 3a 66kD; N-terminus C2H2 domain ; K12826 splicing factor 3A subunit 2 Length=216 Score = 100 bits (250), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (1%) Query 17 TIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA-DAVV 75 +IDL+KDPY+M+NHLGQ ECRLC T+HTNEGSYLSHTQG+KHQTNL+ R +KEK AVV Sbjct 37 SIDLSKDPYYMKNHLGQVECRLCSTIHTNEGSYLSHTQGRKHQTNLAYRASKEKNLKAVV 96 Query 76 AP 77 P Sbjct 97 KP 98 > sce:YDL043C PRP11, RNA11; Prp11p; K12826 splicing factor 3A subunit 2 Length=266 Score = 45.1 bits (105), Expect = 6e-05, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 0/46 (0%) Query 20 LNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRR 65 + +PY +NH G+ C+LC T+H + S H GKKH N+ RR Sbjct 52 VRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRR 97 > tpv:TP04_0385 hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=259 Score = 35.4 bits (80), Expect = 0.043, Method: Compositional matrix adjust. Identities = 27/77 (35%), Positives = 33/77 (42%), Gaps = 12/77 (15%) Query 16 ETIDLNKDPYFMRNHL----------GQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRR 65 ETID +K Y R+ L G F C+ C L + SYL H GKKH L Sbjct 70 ETIDFSK--YVGRSELVDVDGPKSKQGGFFCKTCNCLLKDSKSYLDHLNGKKHNRLLGMT 127 Query 66 LAKEKADAVVAPMPLKR 82 + EK A L+R Sbjct 128 MRVEKVSAKAVADKLRR 144 > ath:AT5G61190 zinc finger protein-related Length=977 Score = 35.0 bits (79), Expect = 0.060, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query 36 CRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVAP 77 C++C TN +Y +HT GKKH+ NL + K K + +V P Sbjct 299 CKVCQISFTNNDTYKNHTYGKKHRNNLELQSGKSK-NILVGP 339 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 36 CRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEK 70 C++C ++ ++ SHT GKKH+ NL + AK + Sbjct 684 CQVCQISCNSKVAFASHTYGKKHRQNLESQSAKNE 718 > hsa:91603 ZNF830, CCDC16, MGC20398, OMCG1, SEL13; zinc finger protein 830; K13104 zinc finger protein 830 Length=372 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query 7 KERLRRLALETIDLN------KDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 +E LRRL E L+ + P+ N LGQ C LC T +E + +H GK+H+ Sbjct 18 QEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHRE 77 Query 61 NLS 63 ++ Sbjct 78 KVA 80 > mmu:66983 Zfp830, 2410003C20Rik, AV301118, AW048207, Ccdc16, Omcg1, Znf830; zinc finger protein 830; K13104 zinc finger protein 830 Length=363 Score = 33.1 bits (74), Expect = 0.22, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query 7 KERLRRLALETIDLN------KDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQT 60 +E LRRL E L+ + P+ N LGQ C LC T +E + +H GK+H+ Sbjct 18 QEELRRLMREKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHRE 77 Query 61 NLS 63 ++ Sbjct 78 RVA 80 > hsa:79842 ZBTB3, FLJ23392; zinc finger and BTB domain containing 3; K10490 zinc finger and BTB domain-containing protein 3 Length=574 Score = 32.0 bits (71), Expect = 0.49, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query 34 FECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVAPM 78 +ECR CL +T G H + K H +L++R K D V P+ Sbjct 500 YECRYCLRSYTQSGDLYRHIR-KAHNEDLAKR---SKPDPEVGPL 540 > bbo:BBOV_II002560 18.m06206; hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=232 Score = 32.0 bits (71), Expect = 0.52, Method: Compositional matrix adjust. Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 9/86 (10%) Query 5 ERKERLRRLALETIDLNKDPYFMR--------NHLGQFECRLCLTLHTNEGSYLSHTQGK 56 E +E L+R E +D+ KD +R + G F C+ C + + +Y+ H G+ Sbjct 62 EVRENLKRRK-EFVDVTKDVGKVRVINALTHKSQQGGFYCKTCDCILKDSQAYMDHLNGR 120 Query 57 KHQTNLSRRLAKEKADAVVAPMPLKR 82 KH L + EK D L+R Sbjct 121 KHNRMLGMTMRVEKVDHKAVAEALRR 146 > dre:324476 zmat2, fc30d10, flj31121, wu:fc30d10; zinc finger, matrin type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=198 Score = 31.6 bits (70), Expect = 0.67, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query 31 LGQFECRLCLTLHTNEGSYLSHTQGKKHQTNL--SRRLAKEKADAV 74 +G + C +C + + ++L H GKKHQ NL S R+ + D V Sbjct 76 MGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQV 121 > mmu:66492 Zmat2, 2610510D14Rik, 2900082I05Rik; zinc finger, matrin type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 31.6 bits (70), Expect = 0.70, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNL--SRRLAKEKADAV 74 ++ +G + C +C + + ++L H GKKHQ NL S R+ + D V Sbjct 74 QSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQV 122 > hsa:153527 ZMAT2, FLJ31121, Snu23, hSNU23; zinc finger, matrin-type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 31.6 bits (70), Expect = 0.70, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNL--SRRLAKEKADAV 74 ++ +G + C +C + + ++L H GKKHQ NL S R+ + D V Sbjct 74 QSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQV 122 > mmu:105835 Sgsm3, 1810012I01Rik, AI428557, BB175482, Cip85, R75178, RUSC3, Rutbc3; small G protein signaling modulator 3 Length=760 Score = 31.2 bits (69), Expect = 0.94, Method: Compositional matrix adjust. Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 8/84 (9%) Query 2 VNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTN 61 V+L R E+LR L L I P+ MR Q RL L + S LS+ + K+ +N Sbjct 109 VSLPRSEKLRSLVLAGI-----PHGMRP---QLWMRLSGALQKKKNSELSYREIIKNSSN 160 Query 62 LSRRLAKEKADAVVAPMPLKRCYC 85 AK+ ++ MP C+ Sbjct 161 DETIAAKQIEKDLLRTMPSNACFA 184 > xla:495824 zmat2, snu23; zinc finger, matrin-type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 30.8 bits (68), Expect = 0.96, Method: Compositional matrix adjust. Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA 71 ++ +G + C +C + + ++L H GKKHQ NL + E++ Sbjct 74 QSDMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERS 117 > hsa:27352 SGSM3, DKFZp761D051, MAP, RUSC3, RUTBC3; small G protein signaling modulator 3 Length=749 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 8/84 (9%) Query 2 VNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTN 61 V+L R E+LR L L I P+ MR Q RL L S LS+ + K+ +N Sbjct 99 VSLPRSEKLRSLVLAGI-----PHGMRP---QLWMRLSGALQKKRNSELSYREIVKNSSN 150 Query 62 LSRRLAKEKADAVVAPMPLKRCYC 85 AK+ ++ MP C+ Sbjct 151 DETIAAKQIEKDLLRTMPSNACFA 174 > ath:AT3G05760 nucleic acid binding / zinc ion binding; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=202 Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 0/36 (0%) Query 36 CRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA 71 CR+C + + +YL H GKKHQ L + E++ Sbjct 85 CRVCDCVVKDSANYLDHINGKKHQRALGMSMRVERS 120 > dre:791686 cadherin 1, type 1 preproprotein-like Length=777 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 10/87 (11%) Query 3 NLERKERLRRLALETIDLNKDPYFMR-------NHLGQFECRLCLTLHT--NEGSYLS-H 52 +L R ERL R+ T D YF N G R +TLH E S + Sbjct 50 HLHRGERLGRVRFNTCDRRTRVYFQSTDQEIDLNRDGTLMMRRSVTLHEGFKEFSVTAWD 109 Query 53 TQGKKHQTNLSRRLAKEKADAVVAPMP 79 + GKKH T++ + +D +V P Sbjct 110 SSGKKHTTSVRVERMESSSDDLVLTFP 136 > hsa:64852 TUT1, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, PAPD2, RBM21, STARPAP, TUTase; terminal uridylyl transferase 1, U6 snRNA-specific (EC:2.7.7.19 2.7.7.52) Length=912 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Query 9 RLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAK 68 R RR+A+ +D + + G F C LC N S +H G+KH+ + R A+ Sbjct 33 RYRRVAMAAVDSDVESL----PRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAAR 88 Query 69 E 69 + Sbjct 89 K 89 > ath:AT2G19380 RNA recognition motif (RRM)-containing protein Length=613 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 33 QFECRLCLTLHTNEGSYLSHTQGKKHQ 59 Q+ C LC T E Y +H GKKHQ Sbjct 84 QWFCSLCNATMTCEQDYFAHVYGKKHQ 110 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 36 CRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEK 70 C LC T+E + L+H GKKH+ + R A+++ Sbjct 156 CSLCDINATSEQTLLAHANGKKHRVKVERFDAEQQ 190 > hsa:23567 ZNF346, DKFZp547M223, JAZ, Zfp346; zinc finger protein 346 Length=294 Score = 29.6 bits (65), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLA 67 +C++C L +E L+H Q KKH + R LA Sbjct 74 QCKVCCALLISESQKLAHYQSKKHANKVKRYLA 106 > mmu:75291 Zbtb3, 4930563M09Rik; zinc finger and BTB domain containing 3; K10490 zinc finger and BTB domain-containing protein 3 Length=518 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query 34 FECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKE-KADAVVAPMPL 80 +ECR CL +T G H + K H +L++R + +A ++ PL Sbjct 446 YECRYCLRSYTQSGDLYRHIR-KAHNEDLAKRSKPDPEASTILGVQPL 492 > tgo:TGME49_075310 hypothetical protein Length=551 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 0/44 (0%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA 71 R G F C +C L + +Y+ H G+ H L + E+A Sbjct 357 RMQQGGFWCDVCECLIKDSAAYMDHINGRNHNRMLGMTMRVERA 400 > ath:AT1G06490 ATGSL07 (glucan synthase-like 7); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups; K11000 callose synthase [EC:2.4.1.-] Length=1933 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 5/30 (16%) Query 11 RRLALETIDLNKDPYF-----MRNHLGQFE 35 R AL+TID+N+D YF MRN L +F+ Sbjct 1314 RGEALQTIDMNQDNYFEECFKMRNVLQEFD 1343 > xla:380471 znf346, DsRBP-ZFa, MGC52555, ZFa, jaz; zinc finger protein 346 Length=524 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 0/47 (0%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVAPMPLK 81 +C++C + +E L+H Q +KH + R +A + + V K Sbjct 35 QCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFK 81 Score = 28.1 bits (61), Expect = 7.8, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query 34 FECRLCLTLHTNEGSYLSHTQGKKHQTNLSRR--LAKEKADAVVAP 77 F C C + + Y +H G KH+ L L++E AVVAP Sbjct 229 FSCDKCNIVLNSIEQYQAHVSGAKHKNQLMSMTPLSEEGHQAVVAP 274 > dre:394174 pik3cd, MGC63473, zgc:63473; phosphoinositide-3-kinase, catalytic, delta polypeptide (EC:2.7.1.153); K00922 phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153] Length=1039 Score = 28.9 bits (63), Expect = 3.9, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 40 LTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVAPMPLKR 82 LT H Y S + ++ Q+ LS ++++ +A + P+PLKR Sbjct 269 LTPHLTMVHYSSIVKYQEEQSGLSNQVSRSRAQSKPPPLPLKR 311 > pfa:PFL2075c conserved Plasmodium protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=242 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 6/57 (10%) Query 5 ERKERL---RRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKH 58 ERKE L + L I K P +N G + C++C + + +YL H GK H Sbjct 83 ERKENLLLEKNLGKVQILTQKTP---KNEQGGYYCKICDCVLKDSQTYLDHINGKNH 136 > mmu:26919 Zfp346, Jaz, Znf346; zinc finger protein 346 Length=294 Score = 28.9 bits (63), Expect = 4.2, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLA 67 +C++C + +E L+H Q KKH + R LA Sbjct 74 QCKVCCAMLISESQKLAHYQSKKHANKVKRYLA 106 > dre:560756 znf346, MGC158750, im:7136406, wu:fc21c04, zgc:158750; zinc finger protein 346 Length=301 Score = 28.9 bits (63), Expect = 4.4, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVA 76 +C++C + +E L+H Q KKH + + R ++ ++ +A Sbjct 56 QCKVCSAVLISESQKLAHYQSKKHASKVRRYMSIHGSEEPIA 97 > pfa:PF14_0612 conserved Plasmodium protein, unknown function; K14821 bud site selection protein 20 Length=104 Score = 28.5 bits (62), Expect = 4.8, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query 32 GQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA 71 GQF+C C N + + H + KKH+ + ++L +EKA Sbjct 52 GQFKCFACDIYFINNDAKIQHEKSKKHKRRV-KQLNQEKA 90 > cel:ZK686.4 hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=217 Score = 28.5 bits (62), Expect = 4.8, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 0/40 (0%) Query 32 GQFECRLCLTLHTNEGSYLSHTQGKKHQTNLSRRLAKEKA 71 G F C +C + + ++L H GK HQ N+ + +K+ Sbjct 88 GGFYCDVCDCVVKDSINFLDHINGKNHQRNIGMSMKTKKS 127 > cel:Y95B8A.7 hypothetical protein Length=608 Score = 28.5 bits (62), Expect = 5.8, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Query 34 FECRLCLTLHTNEGSYLSHTQGKKH--QTNLSRRLAK---EKADAVVAP 77 + C LC T + +Y +H +G KH L ++L K E ++AP Sbjct 18 YRCDLCDVTCTGQDTYSAHVRGGKHLKTAQLHKKLGKPVPEDVPTIIAP 66 > mmu:244891 Scaper, C430017I08, D530014O03Rik, Zfp291; S phase cyclin A-associated protein in the ER Length=1398 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQTNL---SRRLAKEKADAVVAPMPLKR 82 +C LC L +E SH +GKKHQ + S +E +D V + LK+ Sbjct 792 QCSLCNVLIASEVYLFSHIKGKKHQQAVRENSSIQGRELSDEEVEHLSLKK 842 > mmu:320158 Zmat4, 9630048M01Rik, MGC90808; zinc finger, matrin type 4 Length=229 Score = 28.1 bits (61), Expect = 7.4, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 0/57 (0%) Query 6 RKERLRRLALETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTNL 62 +K R LE + + D +R + C C + Y +H QG KHQTNL Sbjct 170 KKNAARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNL 226 > xla:378688 trove2, ssa2, ssa2-A; TROVE domain family, member 2; K11089 60 kDa SS-A/Ro ribonucleoprotein Length=538 Score = 28.1 bits (61), Expect = 7.4, Method: Compositional matrix adjust. Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 10/76 (13%) Query 4 LERKERLRRLA--LETIDLNKDPYFMRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQTN 61 LE ER++R LE I L + +R HL LT+H T Sbjct 229 LEATERVKRTKDELEIIHLIDEYRLVREHL--------LTIHLKSKEIWKSLLQDMPLTA 280 Query 62 LSRRLAKEKADAVVAP 77 L R L K AD+V+AP Sbjct 281 LLRNLGKMTADSVLAP 296 > xla:399224 zfr; zinc finger RNA binding protein; K13203 zinc finger RNA-binding protein Length=1054 Score = 27.7 bits (60), Expect = 8.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 0/33 (0%) Query 27 MRNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQ 59 +R Q C LC T +Y +H +G KHQ Sbjct 366 VRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQ 398 > dre:321659 zfr, hnrpa1, wu:fb25b08, zgc:66235, zgc:66403; zinc finger RNA binding protein; K13203 zinc finger RNA-binding protein Length=1052 Score = 27.7 bits (60), Expect = 8.6, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 0/32 (0%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQ 59 R Q C LC T +Y +H +G KHQ Sbjct 350 RGTQNQLRCELCDVSCTGADAYAAHIRGAKHQ 381 > mmu:22763 Zfr, C920030H05Rik, MGC176100; zinc finger RNA binding protein; K13203 zinc finger RNA-binding protein Length=1074 Score = 27.7 bits (60), Expect = 8.8, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 0/32 (0%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQ 59 R Q C LC T +Y +H +G KHQ Sbjct 376 RGTQNQLRCELCDVSCTGADAYAAHIRGAKHQ 407 > hsa:51663 ZFR, FLJ41312, ZFR1; zinc finger RNA binding protein; K13203 zinc finger RNA-binding protein Length=1074 Score = 27.7 bits (60), Expect = 8.8, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 0/32 (0%) Query 28 RNHLGQFECRLCLTLHTNEGSYLSHTQGKKHQ 59 R Q C LC T +Y +H +G KHQ Sbjct 376 RGTQNQLRCELCDVSCTGADAYAAHIRGAKHQ 407 > dre:100144551 scaper; S phase cyclin A-associated protein in the ER Length=1318 Score = 27.7 bits (60), Expect = 9.0, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 35 ECRLCLTLHTNEGSYLSHTQGKKHQ 59 +C LC + T+E SH +GK+HQ Sbjct 713 QCSLCNVVITSEVHLFSHIKGKRHQ 737 > dre:567465 zfr2, MGC174987, si:ch211-63j24.3, wu:fb99a09, zfr; zinc finger RNA binding protein 2 Length=999 Score = 27.7 bits (60), Expect = 9.6, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 0/27 (0%) Query 33 QFECRLCLTLHTNEGSYLSHTQGKKHQ 59 Q C LC T +Y +H +G KHQ Sbjct 360 QLRCELCDVSCTGADAYAAHIRGSKHQ 386 Lambda K H 0.323 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2026251472 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40