bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2500_orf1 Length=86 Score E Sequences producing significant alignments: (Bits) Value eco:b4263 yjgR, ECK4256, JW4220; conserved protein, DUF853 fam... 64.7 7e-11 mmu:67109 Zfp787, 2210018M03Rik, Znf787; zinc finger protein 787 31.6 dre:558609 fj65a11, wu:fj65a11; si:dkey-73n10.1 30.4 1.6 hsa:126208 ZNF787, TIP20; zinc finger protein 787 29.6 dre:100001432 eKir-like; K05009 potassium inwardly-rectifying ... 29.3 3.4 cpv:cgd3_270 hypothetical protein 28.9 4.6 > eco:b4263 yjgR, ECK4256, JW4220; conserved protein, DUF853 family with NTPase fold; K06915 Length=500 Score = 64.7 bits (156), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 33/86 (38%), Positives = 54/86 (62%), Gaps = 0/86 (0%) Query 1 FKVADREGLLLLDLKDLKALLNHLRYHPELLGEDAALMTTGSSLALLRRLAVLEQQGAEA 60 F++AD +GLLLLD KDL+A+ ++ + + +++ S A+ R L LEQQGA Sbjct 138 FRIADDQGLLLLDFKDLRAITQYIGDNAKSFQNQYGNISSASVGAIQRGLLSLEQQGAAH 197 Query 61 LFGEPALQLEDILQPANDGRGRIHLL 86 FGEP L ++D ++ +G+G I++L Sbjct 198 FFGEPMLDIKDWMRTDANGKGVINIL 223 > mmu:67109 Zfp787, 2210018M03Rik, Znf787; zinc finger protein 787 Length=381 Score = 31.6 bits (70), Expect = 0.64, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 30/66 (45%), Gaps = 12/66 (18%) Query 18 KALLNHLRYHPELLGEDAALMTTGSSLALLRRLAVLEQQGAEALFGEPALQLEDILQPAN 77 K+L HLR HPEL G A +S +RR E+ A A GE A+ P Sbjct 191 KSLARHLRLHPELSGPGVAAKVLAAS---VRRAKAPEE--ATAADGEIAI-------PVG 238 Query 78 DGRGRI 83 DG G I Sbjct 239 DGEGII 244 > dre:558609 fj65a11, wu:fj65a11; si:dkey-73n10.1 Length=1277 Score = 30.4 bits (67), Expect = 1.6, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Query 25 RYHPELLGEDAALMTTGSSLALLRRLAVLEQQGAEALFGEPALQLEDILQPANDGR 80 R P + ED A A RLA L ++G EAL + LQLE ++ DG+ Sbjct 212 RMSPHIYDEDWA--------AHYSRLAYLHKKGQEALAQQRGLQLEHGVEGIKDGK 259 > hsa:126208 ZNF787, TIP20; zinc finger protein 787 Length=382 Score = 29.6 bits (65), Expect = 2.4, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 30/66 (45%), Gaps = 12/66 (18%) Query 18 KALLNHLRYHPELLGEDAALMTTGSSLALLRRLAVLEQQGAEALFGEPALQLEDILQPAN 77 K+L HLR HPEL G A +S +RR E+ A A GE A+ P Sbjct 191 KSLARHLRLHPELSGPGVAAKVLAAS---VRRAKGPEE--AVAADGEIAI-------PVG 238 Query 78 DGRGRI 83 DG G I Sbjct 239 DGEGII 244 > dre:100001432 eKir-like; K05009 potassium inwardly-rectifying channel subfamily J member 16 Length=494 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query 32 GEDAALMT-TGSSLALLRRLAVLEQQGAEALFGEPALQLEDILQPANDGRGRIHL 85 GE ++++ GSS + L+ LE +G+ AL GE + LED A +G G L Sbjct 12 GEGSSVLEGEGSSALEDKGLSALENEGSSALKGEGSSALEDEGSSALEGEGSSEL 66 > cpv:cgd3_270 hypothetical protein Length=1130 Score = 28.9 bits (63), Expect = 4.6, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 1 FKVADREGLLLLDLKDLKALLNHLRYHPELLGEDAAL 37 FKV DR +L L K L L L Y+P +L D L Sbjct 432 FKVQDRINILPLKFKSLNDKLYSLCYYPYILTSDICL 468 Lambda K H 0.321 0.141 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2030857360 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40