bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2364_orf1 Length=76 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_060240 CCR4-NOT transcription complex subunit, puta... 108 4e-24 pfa:MAL8P1.104 CAF1 family ribonuclease, putative; K12581 CCR4... 98.6 4e-21 tpv:TP04_0580 hypothetical protein; K12581 CCR4-NOT transcript... 92.4 3e-19 bbo:BBOV_III006830 17.m07605; CAF1 family ribonuclease contain... 88.6 5e-18 ath:AT1G80780 CCR4-NOT transcription complex protein, putative... 80.5 1e-15 mmu:69125 Cnot8, 1500015I04Rik, 1810022F04Rik, AA536816, AU015... 80.1 2e-15 hsa:9337 CNOT8, CAF1, CALIF, POP2, hCAF1; CCR4-NOT transcripti... 80.1 2e-15 dre:768119 cnot7, CAF1, fd59c07, fj07d05, wu:fd59c07, wu:fj07d... 79.0 3e-15 dre:406788 cnot8, wu:fe49a05, zgc:63844; CCR4-NOT transcriptio... 78.2 7e-15 mmu:18983 Cnot7, AU022737, Caf1, Pop2; CCR4-NOT transcription ... 77.8 7e-15 dre:100334227 CCR4-NOT transcription complex, subunit 8-like 77.8 7e-15 hsa:29883 CNOT7, CAF1, hCAF-1; CCR4-NOT transcription complex,... 77.8 8e-15 cpv:cgd3_350 Pop2p-like 3'5' exonuclease, CCR4-NOT transcripti... 77.8 9e-15 xla:734751 cnot7, MGC130876, caf1; CCR4-NOT transcription comp... 76.6 2e-14 xla:379811 cnot8, MGC52767; CCR4-NOT transcription complex, su... 76.3 2e-14 ath:AT2G32070 CCR4-NOT transcription complex protein, putative 75.9 3e-14 ath:AT5G10960 CCR4-NOT transcription complex protein, putative... 70.9 1e-12 ath:AT1G15920 CCR4-NOT transcription complex protein, putative 70.5 1e-12 cel:Y56A3A.20 ccf-1; yeast CCR4 Associated Factor family membe... 66.2 2e-11 ath:AT3G44260 CCR4-NOT transcription complex protein, putative 62.8 3e-10 ath:AT5G22250 CCR4-NOT transcription complex protein, putative 60.1 2e-09 ath:AT1G06450 CCR4-NOT transcription complex protein, putative 55.8 3e-08 ath:AT1G27890 CCR4-NOT transcription complex protein, putative 52.4 4e-07 sce:YNR052C POP2, CAF1; Pop2p (EC:3.1.13.4); K12581 CCR4-NOT t... 48.5 5e-06 ath:AT1G27820 CCR4-NOT transcription complex protein, putative 48.1 7e-06 ath:AT1G61470 CCR4-NOT transcription complex protein, putative 46.6 2e-05 ath:AT3G44240 CCR4-NOT transcription complex protein, putative 33.5 0.17 > tgo:TGME49_060240 CCR4-NOT transcription complex subunit, putative (EC:3.1.13.4); K12581 CCR4-NOT transcription complex subunit 7/8 Length=617 Score = 108 bits (270), Expect = 4e-24, Method: Composition-based stats. Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 3/75 (4%) Query 2 MNGYGDGLRGQIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYN 61 MNG G R QI+EVW HNLEEE RI DVVER+ YIA+DTEFPGIV RPT N DYN Sbjct 1 MNGEC-GEREQIVEVWEHNLEEEFARIRDVVERFQYIAMDTEFPGIVARPTG--NVTDYN 57 Query 62 YRIVKYNVDLLKVIQ 76 Y+ VKYNVDLLKVIQ Sbjct 58 YQTVKYNVDLLKVIQ 72 > pfa:MAL8P1.104 CAF1 family ribonuclease, putative; K12581 CCR4-NOT transcription complex subunit 7/8 Length=1774 Score = 98.6 bits (244), Expect = 4e-21, Method: Composition-based stats. Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 2/67 (2%) Query 10 RGQIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNV 69 R +I++VWA+NLEEE +RI D+VE++PY+A+DTEFPGIV RPT N LDYNY+ +K NV Sbjct 4 RTKIVDVWANNLEEEFERIRDIVEKHPYVAIDTEFPGIVARPTG--NVLDYNYQTIKCNV 61 Query 70 DLLKVIQ 76 DLLKVIQ Sbjct 62 DLLKVIQ 68 > tpv:TP04_0580 hypothetical protein; K12581 CCR4-NOT transcription complex subunit 7/8 Length=562 Score = 92.4 bits (228), Expect = 3e-19, Method: Composition-based stats. Identities = 41/65 (63%), Positives = 53/65 (81%), Gaps = 2/65 (3%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDL 71 QI++VW+ NLE+ DRI D++E+YPY+++DTEFPGIV RPTS L DYNY+ VK NVDL Sbjct 6 QIVDVWSDNLEDAFDRIRDLLEQYPYVSIDTEFPGIVVRPTSYLE--DYNYQTVKCNVDL 63 Query 72 LKVIQ 76 L +IQ Sbjct 64 LNIIQ 68 > bbo:BBOV_III006830 17.m07605; CAF1 family ribonuclease containing protein; K12581 CCR4-NOT transcription complex subunit 7/8 Length=374 Score = 88.6 bits (218), Expect = 5e-18, Method: Composition-based stats. Identities = 39/65 (60%), Positives = 53/65 (81%), Gaps = 2/65 (3%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDL 71 +I++VW+ NLE+ +RI DV+ERYPY+++DTEFPGIV +PT+ DYNY+ VK NVDL Sbjct 6 KIVDVWSDNLEDAFERIRDVLERYPYVSIDTEFPGIVAKPTTYQE--DYNYQTVKCNVDL 63 Query 72 LKVIQ 76 LK+IQ Sbjct 64 LKLIQ 68 > ath:AT1G80780 CCR4-NOT transcription complex protein, putative; K12581 CCR4-NOT transcription complex subunit 7/8 Length=274 Score = 80.5 bits (197), Expect = 1e-15, Method: Composition-based stats. Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 QI EVW NL+EE+D I DVV+ +PY+A+DTEFPGIV RP + DY+Y +K NV+ Sbjct 11 QIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADYHYETLKTNVN 70 Query 71 LLKVIQ 76 +LK+IQ Sbjct 71 ILKMIQ 76 > mmu:69125 Cnot8, 1500015I04Rik, 1810022F04Rik, AA536816, AU015770, AU043059; CCR4-NOT transcription complex, subunit 8; K12581 CCR4-NOT transcription complex subunit 7/8 Length=292 Score = 80.1 bits (196), Expect = 2e-15, Method: Composition-based stats. Identities = 36/65 (55%), Positives = 50/65 (76%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSML-NALDYNYRIVKYNVDL 71 I EVWA NLEEE+ +I ++V Y YIA+DTEFPG+V RP +++DY Y++++ NVDL Sbjct 12 ICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDL 71 Query 72 LKVIQ 76 LK+IQ Sbjct 72 LKIIQ 76 > hsa:9337 CNOT8, CAF1, CALIF, POP2, hCAF1; CCR4-NOT transcription complex, subunit 8; K12581 CCR4-NOT transcription complex subunit 7/8 Length=292 Score = 80.1 bits (196), Expect = 2e-15, Method: Composition-based stats. Identities = 36/65 (55%), Positives = 50/65 (76%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSML-NALDYNYRIVKYNVDL 71 I EVWA NLEEE+ +I ++V Y YIA+DTEFPG+V RP +++DY Y++++ NVDL Sbjct 12 ICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDL 71 Query 72 LKVIQ 76 LK+IQ Sbjct 72 LKIIQ 76 > dre:768119 cnot7, CAF1, fd59c07, fj07d05, wu:fd59c07, wu:fj07d05, zgc:153168; CCR4-NOT transcription complex, subunit 7; K12581 CCR4-NOT transcription complex subunit 7/8 Length=286 Score = 79.0 bits (193), Expect = 3e-15, Method: Composition-based stats. Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 +I EVWA NLEEE+ RI V ++ YIA+DTEFPG+V RP + DY Y++++ NVD Sbjct 11 RICEVWACNLEEEMKRIRQVTRKFNYIAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD 70 Query 71 LLKVIQ 76 LLK+IQ Sbjct 71 LLKIIQ 76 > dre:406788 cnot8, wu:fe49a05, zgc:63844; CCR4-NOT transcription complex, subunit 8; K12581 CCR4-NOT transcription complex subunit 7/8 Length=285 Score = 78.2 bits (191), Expect = 7e-15, Method: Composition-based stats. Identities = 33/65 (50%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVDL 71 I EVWA N+EEE+ +I +++ Y YIA+DTEFPG+V RP + +DY Y++++ NVDL Sbjct 12 ICEVWASNVEEEMRKIRQIIQNYNYIAMDTEFPGVVVRPIGEFRSTVDYQYQLLRCNVDL 71 Query 72 LKVIQ 76 LK++Q Sbjct 72 LKIVQ 76 > mmu:18983 Cnot7, AU022737, Caf1, Pop2; CCR4-NOT transcription complex, subunit 7; K12581 CCR4-NOT transcription complex subunit 7/8 Length=285 Score = 77.8 bits (190), Expect = 7e-15, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 +I EVWA NL+EE+ +I V+ +Y Y+A+DTEFPG+V RP + DY Y++++ NVD Sbjct 11 RICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD 70 Query 71 LLKVIQ 76 LLK+IQ Sbjct 71 LLKIIQ 76 > dre:100334227 CCR4-NOT transcription complex, subunit 8-like Length=247 Score = 77.8 bits (190), Expect = 7e-15, Method: Composition-based stats. Identities = 34/65 (52%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVDL 71 I EVWA N+EEE+ +I +++ Y YIA+DTEFPG+V RP + +DY Y++++ NVDL Sbjct 12 ICEVWASNVEEEMRKIRQIIQNYNYIAMDTEFPGVVVRPIGEFRSTVDYQYQLLRCNVDL 71 Query 72 LKVIQ 76 LK+IQ Sbjct 72 LKIIQ 76 > hsa:29883 CNOT7, CAF1, hCAF-1; CCR4-NOT transcription complex, subunit 7; K12581 CCR4-NOT transcription complex subunit 7/8 Length=285 Score = 77.8 bits (190), Expect = 8e-15, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 +I EVWA NL+EE+ +I V+ +Y Y+A+DTEFPG+V RP + DY Y++++ NVD Sbjct 11 RICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD 70 Query 71 LLKVIQ 76 LLK+IQ Sbjct 71 LLKIIQ 76 > cpv:cgd3_350 Pop2p-like 3'5' exonuclease, CCR4-NOT transcription complex ; K12581 CCR4-NOT transcription complex subunit 7/8 Length=277 Score = 77.8 bits (190), Expect = 9e-15, Method: Composition-based stats. Identities = 34/67 (50%), Positives = 50/67 (74%), Gaps = 2/67 (2%) Query 10 RGQIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNV 69 +G I EVW +N+ E I ++++ +PY+A+DTEFPG+V RPT+ N +Y Y+ V++NV Sbjct 15 KGVIYEVWQNNINEAFQMISEIMDDFPYVAIDTEFPGVVVRPTN--NYYEYYYQTVRFNV 72 Query 70 DLLKVIQ 76 DLLKVIQ Sbjct 73 DLLKVIQ 79 > xla:734751 cnot7, MGC130876, caf1; CCR4-NOT transcription complex, subunit 7; K12581 CCR4-NOT transcription complex subunit 7/8 Length=285 Score = 76.6 bits (187), Expect = 2e-14, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 49/66 (74%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 +I EVWA NL++++ RI V+ +Y Y+A+DTEFPG+V RP + DY Y++++ NVD Sbjct 11 RICEVWACNLDDQMKRIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD 70 Query 71 LLKVIQ 76 LLK+IQ Sbjct 71 LLKIIQ 76 > xla:379811 cnot8, MGC52767; CCR4-NOT transcription complex, subunit 8; K12581 CCR4-NOT transcription complex subunit 7/8 Length=289 Score = 76.3 bits (186), Expect = 2e-14, Method: Composition-based stats. Identities = 35/65 (53%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVDL 71 I EVWA NLEEE+ +I ++V + YIA+DTEFPG+V RP + +DY Y++++ NVDL Sbjct 12 ICEVWAVNLEEEMRKIRELVRTHGYIAMDTEFPGVVVRPIGEFRSTIDYQYQLLRCNVDL 71 Query 72 LKVIQ 76 LK+IQ Sbjct 72 LKIIQ 76 > ath:AT2G32070 CCR4-NOT transcription complex protein, putative Length=275 Score = 75.9 bits (185), Expect = 3e-14, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVD 70 QI EVW NLE E+ I +VV+ +P++A+DTEFPGIVCRP +Y+Y +K NV+ Sbjct 11 QIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEYHYETLKTNVN 70 Query 71 LLKVIQ 76 +LK+IQ Sbjct 71 ILKMIQ 76 > ath:AT5G10960 CCR4-NOT transcription complex protein, putative; K12581 CCR4-NOT transcription complex subunit 7/8 Length=277 Score = 70.9 bits (172), Expect = 1e-12, Method: Composition-based stats. Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLN-ALDYNYRIVKYNVDL 71 I EVW +NL EE I ++V+++ YIA+DTEFPG+V +P + D NYR +K NVDL Sbjct 12 IREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDLNYRTLKENVDL 71 Query 72 LKVIQ 76 LK+IQ Sbjct 72 LKLIQ 76 > ath:AT1G15920 CCR4-NOT transcription complex protein, putative Length=286 Score = 70.5 bits (171), Expect = 1e-12, Method: Composition-based stats. Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 7/72 (9%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCR-------PTSMLNALDYNYRI 64 +I EVW HNLE+E+ I ++ +PY+A+DTEFPGIVC+ P +YNY Sbjct 15 EIREVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPYSIHYEYNYDT 74 Query 65 VKYNVDLLKVIQ 76 +K NV++LK+IQ Sbjct 75 LKANVNMLKLIQ 86 > cel:Y56A3A.20 ccf-1; yeast CCR4 Associated Factor family member (ccf-1); K12581 CCR4-NOT transcription complex subunit 7/8 Length=310 Score = 66.2 bits (160), Expect = 2e-11, Method: Composition-based stats. Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Query 12 QIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNAL-DYNYRIVKYNVD 70 +I V+ N+EEE RI VE YPY+A+DTEFPG+V P + D+NY+ V NV+ Sbjct 22 KIHNVYMSNVEEEFARIRGFVEDYPYVAMDTEFPGVVATPLGTFRSKEDFNYQQVFCNVN 81 Query 71 LLKVIQ 76 +LK+IQ Sbjct 82 MLKLIQ 87 > ath:AT3G44260 CCR4-NOT transcription complex protein, putative Length=280 Score = 62.8 bits (151), Expect = 3e-10, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 0/70 (0%) Query 7 DGLRGQIIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVK 66 DG+ EVWA NLE E + I ++++ YP+I++DTEFPG++ + D Y ++K Sbjct 13 DGVTVVTREVWAENLESEFELISEIIDDYPFISMDTEFPGVIFKSDLRFTNPDDLYTLLK 72 Query 67 YNVDLLKVIQ 76 NVD L +IQ Sbjct 73 ANVDALSLIQ 82 > ath:AT5G22250 CCR4-NOT transcription complex protein, putative Length=278 Score = 60.1 bits (144), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 7/69 (10%) Query 13 IIEVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNAL-----DYNYRIVKY 67 I +VWA+NLE E D I +VE YP+I++DTEFPG++ + L+ L +Y Y ++K Sbjct 14 IRDVWAYNLESEFDLIRGIVEDYPFISMDTEFPGVIYKAD--LDVLRRGNPNYLYNLLKS 71 Query 68 NVDLLKVIQ 76 NVD L +IQ Sbjct 72 NVDALSLIQ 80 > ath:AT1G06450 CCR4-NOT transcription complex protein, putative Length=360 Score = 55.8 bits (133), Expect = 3e-08, Method: Composition-based stats. Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Query 16 VWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDLLKVI 75 VW N++EE+ R+ + ++R+P IA DTE+PGI+ R T ++ D YR +K NV+ K+I Sbjct 12 VWRSNVDEEMARMAECLKRFPLIAFDTEYPGIIFR-TYFDSSSDECYRAMKGNVENTKLI 70 Query 76 Q 76 Q Sbjct 71 Q 71 > ath:AT1G27890 CCR4-NOT transcription complex protein, putative Length=302 Score = 52.4 bits (124), Expect = 4e-07, Method: Composition-based stats. Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query 15 EVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDLLKV 74 EVW N E E+D I D ++ + IA+DTEFPG + + T M + + YR +K+NVD + Sbjct 3 EVWRWNKEVEMDSIRDCLKHFSSIAIDTEFPGCL-KETPMDASEEIRYRDMKFNVDNTHL 61 Query 75 IQ 76 IQ Sbjct 62 IQ 63 > sce:YNR052C POP2, CAF1; Pop2p (EC:3.1.13.4); K12581 CCR4-NOT transcription complex subunit 7/8 Length=433 Score = 48.5 bits (114), Expect = 5e-06, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query 15 EVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNA-LDYNYRIVKYNVDLLK 73 +VW NL E I +V +Y ++++ TEF G + RP + +DY+Y+ ++ NVD L Sbjct 162 DVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLN 221 Query 74 VIQ 76 IQ Sbjct 222 PIQ 224 > ath:AT1G27820 CCR4-NOT transcription complex protein, putative Length=310 Score = 48.1 bits (113), Expect = 7e-06, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query 15 EVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDLLKV 74 EVW N E E++ I D ++ IA+DTEFPG + + T M + + YR +K+NVD + Sbjct 8 EVWRWNKEVEMNSIRDCLKHCSSIAIDTEFPGCL-KETPMDASEEIRYRDMKFNVDNTHL 66 Query 75 IQ 76 IQ Sbjct 67 IQ 68 > ath:AT1G61470 CCR4-NOT transcription complex protein, putative Length=278 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query 15 EVWAHNLEEEVDRIMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDLLKV 74 EVW N + E++ I D ++ IA+DTEFPG + + T M + + YR +K+NVD + Sbjct 4 EVWRWNKQAEMNSIRDCLKHCNSIAIDTEFPGCL-KETPMDASDEIRYRDMKFNVDNTHL 62 Query 75 IQ 76 IQ Sbjct 63 IQ 64 > ath:AT3G44240 CCR4-NOT transcription complex protein, putative Length=239 Score = 33.5 bits (75), Expect = 0.17, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query 28 IMDVVERYPYIALDTEFPGIVCRPTSMLNALDYNYRIVKYNVDLLKVIQ 76 I D + Y +IA+DTEFP + R T+ + Y + ++VD K+IQ Sbjct 4 IEDCLRSYRFIAIDTEFPSTL-RETTQHATDEERYMDMSFSVDRAKLIQ 51 Lambda K H 0.323 0.144 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2076916240 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40