bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2239_orf1 Length=57 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_019320 acid phosphatase, putative (EC:3.1.3.2); K01... 80.9 1e-15 tpv:TP03_0512 acid phosphatase (EC:3.1.3.2); K01078 acid phosp... 72.4 3e-13 bbo:BBOV_I004700 19.m02068; acid phosphatase (EC:3.1.3.2); K01... 71.6 6e-13 pfa:PFI0880c GAP50; glideosome-associated protein 50 (EC:3.1.3... 68.9 4e-12 cpv:cgd7_4420 secreted acid phosphatase (calcineurin family),s... 40.4 0.001 dre:406801 acp5a, acp5, sb:cb576, wu:fb19f01, wu:fb30b03, wu:f... 36.2 0.030 hsa:54 ACP5, MGC117378, TRAP; acid phosphatase 5, tartrate res... 34.7 0.081 xla:432322 acp5, MGC78938; acid phosphatase 5, tartrate resist... 34.3 0.098 xla:444356 MGC82831 protein; K14379 tartrate-resistant acid ph... 33.9 0.13 ath:AT2G01880 PAP7; PAP7 (PURPLE ACID PHOSPHATASE 7); acid pho... 33.5 0.18 cpv:cgd8_70 hypothetical protein 33.5 0.19 cel:F02E9.7 hypothetical protein; K14379 tartrate-resistant ac... 33.1 0.20 ath:AT2G01890 PAP8; PAP8 (PURPLE ACID PHOSPHATASE 8); acid pho... 32.3 0.43 mmu:11433 Acp5, TRACP, TRAP; acid phosphatase 5, tartrate resi... 31.2 0.88 ath:AT1G25230 purple acid phosphatase family protein 29.3 3.3 dre:436725 acp5b, zgc:92339; acid phosphatase 5b, tartrate res... 28.5 5.8 dre:556728 crfb8, im:7156745, si:ch211-272f15.1, zgc:158705; c... 28.5 6.1 > tgo:TGME49_019320 acid phosphatase, putative (EC:3.1.3.2); K01078 acid phosphatase [EC:3.1.3.2] Length=431 Score = 80.9 bits (198), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/57 (64%), Positives = 43/57 (75%), Gaps = 0/57 (0%) Query 1 PGSNFPNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRERTD 57 PGSNF GVS NDT+W FE+VYSD +G+LKMPF TVLG DDWS NYT+ RT+ Sbjct 89 PGSNFLGGVSSLNDTRWQSEFENVYSDANGALKMPFFTVLGVDDWSRNYTSEALRTE 145 > tpv:TP03_0512 acid phosphatase (EC:3.1.3.2); K01078 acid phosphatase [EC:3.1.3.2] Length=404 Score = 72.4 bits (176), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 0/55 (0%) Query 1 PGSNFPNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRER 55 PG NF NGV+G ND KW + FESVY+D+SG + +P TVLG++DW G+Y A ER Sbjct 68 PGFNFDNGVNGLNDEKWKKFFESVYNDDSGLMDLPMFTVLGSEDWLGDYNAQYER 122 > bbo:BBOV_I004700 19.m02068; acid phosphatase (EC:3.1.3.2); K01078 acid phosphatase [EC:3.1.3.2] Length=395 Score = 71.6 bits (174), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 0/55 (0%) Query 1 PGSNFPNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRER 55 PGSNF GV+G+NDTKWD F+SVY E GS+++P TVLGA DW G++ + R Sbjct 66 PGSNFEYGVTGSNDTKWDTHFQSVYRSEDGSMEIPMFTVLGAGDWLGDFNSQINR 120 > pfa:PFI0880c GAP50; glideosome-associated protein 50 (EC:3.1.3.2); K01078 acid phosphatase [EC:3.1.3.2] Length=396 Score = 68.9 bits (167), Expect = 4e-12, Method: Composition-based stats. Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 0/51 (0%) Query 1 PGSNFPNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 PGSNF +GV G ND W +E VYS+E G + MPF TVLG DW+GNY A Sbjct 64 PGSNFIDGVKGLNDPAWKNLYEDVYSEEKGDMYMPFFTVLGTRDWTGNYNA 114 > cpv:cgd7_4420 secreted acid phosphatase (calcineurin family),signal peptide Length=826 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Query 2 GSNFPN-GVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRER 55 G NF GVS +D W+ FESV+ ES + F VLG DW GN TA +R Sbjct 65 GDNFYRWGVSSVDDPIWENMFESVFDQESLQ-DVQFRCVLGNHDWWGNATAQVDR 118 > dre:406801 acp5a, acp5, sb:cb576, wu:fb19f01, wu:fb30b03, wu:fi14e01, wu:fj66f03, zgc:63825; acid phosphatase 5a, tartrate resistant (EC:3.1.3.2); K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=339 Score = 36.2 bits (82), Expect = 0.030, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRE 54 G NF GV+ ND ++ E+FE VY+ + SL +P+ + G D GN A E Sbjct 80 GDNFYYKGVTDVNDPRFQETFEDVYTQD--SLNIPWYVIAGNHDHVGNVKAQIE 131 > hsa:54 ACP5, MGC117378, TRAP; acid phosphatase 5, tartrate resistant (EC:3.1.3.2); K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=325 Score = 34.7 bits (78), Expect = 0.081, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF GV ND ++ E+FE V+SD S K+P+ + G D GN +A Sbjct 70 GDNFYFTGVQDINDKRFQETFEDVFSDRSLR-KVPWYVLAGNHDHLGNVSA 119 > xla:432322 acp5, MGC78938; acid phosphatase 5, tartrate resistant (EC:3.1.3.2); K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=326 Score = 34.3 bits (77), Expect = 0.098, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF +GV+ +D ++ +FESVYS ES +K P+ + G D GN +A Sbjct 72 GDNFYYDGVTDVSDPRFKITFESVYSSES-LIKHPWYILAGNHDHKGNVSA 121 > xla:444356 MGC82831 protein; K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=325 Score = 33.9 bits (76), Expect = 0.13, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRERTD 57 G NF +GV+ +D ++ +FESVYS ES +K+P+ + G D GN +A T+ Sbjct 71 GDNFYYDGVTDESDPRFKFTFESVYSAES-LVKLPWYILAGNHDHKGNVSAQIAYTN 126 > ath:AT2G01880 PAP7; PAP7 (PURPLE ACID PHOSPHATASE 7); acid phosphatase/ protein serine/threonine phosphatase Length=328 Score = 33.5 bits (75), Expect = 0.18, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query 2 GSNF-PNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF +G+ G ND ++ SF +Y+ SL+ + +VLG D+ GN A Sbjct 80 GDNFYDDGLKGVNDPSFEASFSHIYTHP--SLQKQWYSVLGNHDYRGNVEA 128 > cpv:cgd8_70 hypothetical protein Length=424 Score = 33.5 bits (75), Expect = 0.19, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query 2 GSNF-PNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRERTD 57 G NF GV D W E E + S LK+ + LG DW G+ TA +RT+ Sbjct 69 GDNFYQRGVKSVEDAAWTEILEEPFGKLSKHLKVH--SCLGDHDWRGSTTAQIDRTN 123 > cel:F02E9.7 hypothetical protein; K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=419 Score = 33.1 bits (74), Expect = 0.20, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Query 14 DTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTAMRERT 56 D +++ FE+VY++ S L++P+LT+ G D GN TA E T Sbjct 136 DPRFESRFENVYTNPS--LQVPWLTIAGNHDHFGNVTAEIEYT 176 > ath:AT2G01890 PAP8; PAP8 (PURPLE ACID PHOSPHATASE 8); acid phosphatase/ protein serine/threonine phosphatase Length=335 Score = 32.3 bits (72), Expect = 0.43, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Query 2 GSNF-PNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF +G+ D+++ +SF ++Y+ + SL+ P+ VLG D+ GN A Sbjct 84 GDNFYDDGIISPYDSQFQDSFTNIYT--ATSLQKPWYNVLGNHDYRGNVYA 132 > mmu:11433 Acp5, TRACP, TRAP; acid phosphatase 5, tartrate resistant (EC:3.1.3.2); K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=327 Score = 31.2 bits (69), Expect = 0.88, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF GV A+D ++ E+FE V+SD + +P+ + G D GN +A Sbjct 72 GDNFYFTGVHDASDKRFQETFEDVFSDRALR-NIPWYVLAGNHDHLGNVSA 121 > ath:AT1G25230 purple acid phosphatase family protein Length=339 Score = 29.3 bits (64), Expect = 3.3, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Query 5 FPNGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 + NG+ +D + SF ++Y+ S SL+ P+ VLG D+ G+ A Sbjct 89 YDNGMKSIDDPAFQLSFSNIYT--SPSLQKPWYLVLGNHDYRGDVEA 133 > dre:436725 acp5b, zgc:92339; acid phosphatase 5b, tartrate resistant; K14379 tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2] Length=327 Score = 28.5 bits (62), Expect = 5.8, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query 2 GSNFP-NGVSGANDTKWDESFESVYSDESGSLKMPFLTVLGADDWSGNYTA 51 G NF +GV +DT++ S+E V+S + +P+ + G D GN +A Sbjct 73 GDNFYYDGVKDVDDTRFKFSYEQVFS-HPALMTIPWYLIAGNHDHRGNVSA 122 > dre:556728 crfb8, im:7156745, si:ch211-272f15.1, zgc:158705; cytokine receptor family member b8; K05136 interleukin 20 receptor alpha Length=492 Score = 28.5 bits (62), Expect = 6.1, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 25 YSDESGSLKMPFLTVLGADDWSGNYT 50 +S ESG LK+P + +LG +D SG T Sbjct 426 WSPESGELKIPLMGLLGLEDESGVQT 451 Lambda K H 0.308 0.128 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2082685716 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40