bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2106_orf3 Length=61 Score E Sequences producing significant alignments: (Bits) Value eco:b3985 rplJ, ECK3976, JW3948; 50S ribosomal subunit protein... 75.9 3e-14 > eco:b3985 rplJ, ECK3976, JW3948; 50S ribosomal subunit protein L10; K02864 large subunit ribosomal protein L10 Length=165 Score = 75.9 bits (185), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 40/55 (72%), Positives = 47/55 (85%), Gaps = 0/55 (0%) Query 7 VAINLEDKKAIVAEDNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVRVV 61 +A+NL+DK+AIVAE +E AK ALSAVVAD+RGVTV MT LRK REAGVY+RVV Sbjct 1 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVV 55 Lambda K H 0.312 0.126 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2064920148 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40