bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2012_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_100040 ubiquitin-conjugating enzyme E2, putative (E... 68.6 5e-12 pfa:PF10_0330 ubiquitin conjugating enzyme, putative; K10576 u... 64.7 6e-11 tpv:TP01_0804 ubiquitin-protein ligase; K10576 ubiquitin-conju... 59.3 3e-09 bbo:BBOV_IV009650 23.m05904; ubiquitin-conjugating enzyme subu... 58.5 5e-09 cel:Y94H6A.6 ubc-8; UBiquitin Conjugating enzyme family member... 38.1 0.007 dre:368425 ube2h, fc07a05, fi24c01, si:bz3c13.2, wu:fc07a05, w... 38.1 0.007 mmu:100039133 Gm2058; predicted gene 2058; K10576 ubiquitin-co... 38.1 0.007 xla:380288 ube2h, MGC53494; ubiquitin-conjugating enzyme E2H (... 37.7 0.008 ath:AT2G46030 UBC6; UBC6 (ubiquitin-conjugating enzyme 6); ubi... 35.4 0.050 sce:YEL012W UBC8, GID3; Ubc8p (EC:6.3.2.19); K10576 ubiquitin-... 33.1 0.21 ath:AT1G63800 UBC5; UBC5 (ubiquitin-conjugating enzyme 5); ubi... 32.7 0.30 ath:AT5G41340 UBC4; UBC4 (UBIQUITIN CONJUGATING ENZYME 4); ubi... 32.3 0.39 tpv:TP01_0835 hypothetical protein; K10413 dynein heavy chain ... 31.2 0.73 xla:494760 irf5; interferon regulatory factor 5; K09446 interf... 31.2 0.88 hsa:7328 UBE2H, E2-20K, UBC8, UBCH, UBCH2; ubiquitin-conjugati... 30.4 1.4 xla:394398 cry1, cry1-A, xCRY1; cryptochrome 1 (photolyase-lik... 30.0 1.8 dre:573209 cry2a, MGC110521, zgc:110521; cryptochrome 2a; K022... 30.0 1.9 dre:100003956 cry1a, MGC153885, zcry1a, zgc:153885; cryptochro... 30.0 1.9 dre:557447 fzd9; frizzled homolog 9 (Drosophila); K02842 frizz... 29.3 3.0 ath:AT1G60390 BURP domain-containing protein / polygalacturona... 29.3 3.2 mmu:14371 Fzd9, mfz9; frizzled homolog 9 (Drosophila); K02842 ... 29.3 3.5 mmu:12952 Cry1, AU020726, AU021000, Phll1; cryptochrome 1 (pho... 28.5 5.5 hsa:1407 CRY1, PHLL1; cryptochrome 1 (photolyase-like); K02295... 28.5 6.1 dre:554836 cry1b, fi26e03, wu:fi26e03, zcry1b; cryptochrome 1b 28.1 6.8 > tgo:TGME49_100040 ubiquitin-conjugating enzyme E2, putative (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=240 Score = 68.6 bits (166), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 29/37 (78%), Positives = 35/37 (94%), Gaps = 0/37 (0%) Query 52 QISSSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 Q+SS+RKQCDF KL+MAG+DLELNN +TQDF+VVFHG Sbjct 13 QVSSNRKQCDFTKLMMAGFDLELNNDSTQDFHVVFHG 49 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%) Query 10 IGFLNKILHPNVDEASG 26 IGF+NK+LHPNVDEASG Sbjct 77 IGFMNKMLHPNVDEASG 93 > pfa:PF10_0330 ubiquitin conjugating enzyme, putative; K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=191 Score = 64.7 bits (156), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 0/37 (0%) Query 52 QISSSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 Q S +RKQCDF KL+MAGYDLELNN +TQDF+V+FHG Sbjct 4 QTSLTRKQCDFTKLIMAGYDLELNNGSTQDFDVMFHG 40 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%) Query 10 IGFLNKILHPNVDEASG 26 IGF+NK+LHPNVDEASG Sbjct 68 IGFMNKLLHPNVDEASG 84 > tpv:TP01_0804 ubiquitin-protein ligase; K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=189 Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 0/32 (0%) Query 57 RKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 RKQCDF KLLMAGYDLEL N +TQ+FNV FHG Sbjct 9 RKQCDFTKLLMAGYDLELVNGSTQEFNVTFHG 40 Score = 36.6 bits (83), Expect = 0.021, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%) Query 10 IGFLNKILHPNVDEASG 26 IGF+NK+LHPNVDE+SG Sbjct 68 IGFMNKMLHPNVDESSG 84 > bbo:BBOV_IV009650 23.m05904; ubiquitin-conjugating enzyme subunit (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=191 Score = 58.5 bits (140), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 0/41 (0%) Query 48 MTQVQISSSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 M V IS+ RKQ DF KLLMAGYDLEL N N +FNV FHG Sbjct 1 MNNVSISNVRKQNDFTKLLMAGYDLELINGNMTEFNVTFHG 41 Score = 37.0 bits (84), Expect = 0.016, Method: Compositional matrix adjust. Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%) Query 10 IGFLNKILHPNVDEASG 26 IGFLNK+LHPNVDE SG Sbjct 69 IGFLNKMLHPNVDETSG 85 > cel:Y94H6A.6 ubc-8; UBiquitin Conjugating enzyme family member (ubc-8); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=221 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGFLNKI HPN+DEASG Sbjct 60 DKYPFKSPSIGFLNKIFHPNIDEASG 85 > dre:368425 ube2h, fc07a05, fi24c01, si:bz3c13.2, wu:fc07a05, wu:fi24c01; ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=183 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGF+NKI HPN+DEASG Sbjct 59 DKYPFKSPSIGFMNKIFHPNIDEASG 84 > mmu:100039133 Gm2058; predicted gene 2058; K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=183 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGF+NKI HPN+DEASG Sbjct 59 DKYPFKSPSIGFMNKIFHPNIDEASG 84 > xla:380288 ube2h, MGC53494; ubiquitin-conjugating enzyme E2H (UBC8 homolog) (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=183 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGF+NKI HPN+DEASG Sbjct 59 DKYPFKSPSIGFMNKIFHPNIDEASG 84 > ath:AT2G46030 UBC6; UBC6 (ubiquitin-conjugating enzyme 6); ubiquitin-protein ligase; K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=183 Score = 35.4 bits (80), Expect = 0.050, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 6 KRIIIGFLNKILHPNVDEASG 26 K +GF+NKI HPNVDE+SG Sbjct 62 KSPSVGFVNKIYHPNVDESSG 82 Score = 33.1 bits (74), Expect = 0.21, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 55 SSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 S R++ D KL+M+ Y ++ N + Q F V FHG Sbjct 5 SKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHG 38 > sce:YEL012W UBC8, GID3; Ubc8p (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=218 Score = 33.1 bits (74), Expect = 0.21, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D K IGF+NKI HPN+D ASG Sbjct 57 DNYPYKSPSIGFVNKIFHPNIDIASG 82 Score = 28.9 bits (63), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Query 53 ISSSRK--QCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 +SSS++ + D KLLM+ + ++L N + Q+F+V F G Sbjct 1 MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLG 38 > ath:AT1G63800 UBC5; UBC5 (ubiquitin-conjugating enzyme 5); ubiquitin-protein ligase; K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=185 Score = 32.7 bits (73), Expect = 0.30, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 6 KRIIIGFLNKILHPNVDEASGH 27 K +GF+ KI HPNVDE SG Sbjct 62 KSPSVGFITKIYHPNVDEMSGS 83 Score = 32.3 bits (72), Expect = 0.38, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 55 SSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 S R++ D KL+M+ Y +E+ N Q+F V F G Sbjct 5 SKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSG 38 > ath:AT5G41340 UBC4; UBC4 (UBIQUITIN CONJUGATING ENZYME 4); ubiquitin-protein ligase; K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=187 Score = 32.3 bits (72), Expect = 0.39, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D K +GF+ KI HPNVDE SG Sbjct 57 DAYPYKSPSVGFITKIYHPNVDELSG 82 Score = 32.3 bits (72), Expect = 0.42, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 55 SSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 S R++ D KL+M+ Y +E N Q+F V F+G Sbjct 5 SKRREMDMMKLMMSDYKVETINDGMQEFYVEFNG 38 > tpv:TP01_0835 hypothetical protein; K10413 dynein heavy chain 1, cytosolic Length=1970 Score = 31.2 bits (69), Expect = 0.73, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 15/84 (17%) Query 20 NVDEASGHFQGLPPYLRFWCFLCQIYLKMTQVQISSSRKQCDFAKL------------LM 67 NV+ +S F G+P L F +C +Y ++ + C F L L+ Sbjct 8 NVNLSSKVFTGIPDSLSFISCICDLYFNVSDASVIDILNNCYFDTLSNFIDQNNPEIPLI 67 Query 68 AGYDLELNNKNTQDF-NVVF--HG 88 G+ +L+++N +F N VF HG Sbjct 68 IGFKDDLDSENAHEFSNRVFVSHG 91 > xla:494760 irf5; interferon regulatory factor 5; K09446 interferon regulatory factor 5 Length=517 Score = 31.2 bits (69), Expect = 0.88, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 4 RRKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWCF 40 R KRI + L L+ + GH LPPY F+CF Sbjct 381 REKRIKLFSLETFLNELIACQKGHTSSLPPYEIFFCF 417 > hsa:7328 UBE2H, E2-20K, UBC8, UBCH, UBCH2; ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (EC:6.3.2.19); K10576 ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19] Length=113 Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust. Identities = 11/14 (78%), Positives = 13/14 (92%), Gaps = 0/14 (0%) Query 13 LNKILHPNVDEASG 26 +NKI HPN+DEASG Sbjct 1 MNKIFHPNIDEASG 14 > xla:394398 cry1, cry1-A, xCRY1; cryptochrome 1 (photolyase-like); K02295 cryptochrome Length=616 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Query 30 GLPPYLRFWCFLCQI-YLKMT----QVQISSSRKQCDFAKLL 66 GL PYLRF C C++ Y K+T +V+ +SS + +LL Sbjct 250 GLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL 291 > dre:573209 cry2a, MGC110521, zgc:110521; cryptochrome 2a; K02295 cryptochrome Length=655 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Query 30 GLPPYLRFWCFLCQI-YLKMTQV 51 GL PYLRF C C++ Y K+T + Sbjct 250 GLSPYLRFGCLSCRLFYFKLTDL 272 > dre:100003956 cry1a, MGC153885, zcry1a, zgc:153885; cryptochrome 1a; K02295 cryptochrome Length=619 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Query 30 GLPPYLRFWCFLCQI-YLKMT----QVQISSSRKQCDFAKLL 66 GL PYLRF C C++ Y K+T +V+ +SS + +LL Sbjct 250 GLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL 291 > dre:557447 fzd9; frizzled homolog 9 (Drosophila); K02842 frizzled 9/10 Length=581 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Query 14 NKILHPNVDEASGHFQGLPPYLRFWC------FLCQIYLKMTQVQISSSRKQC 60 N + + + +EAS P +++ C FLC +Y+ M Q+S+S C Sbjct 56 NLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPAC 108 > ath:AT1G60390 BURP domain-containing protein / polygalacturonase, putative Length=624 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 5 RKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWC 39 +K+++IG +N I +V A Q L PYL ++C Sbjct 520 KKKVVIGKVNGINGGDVTRAVSCHQSLYPYLLYYC 554 > mmu:14371 Fzd9, mfz9; frizzled homolog 9 (Drosophila); K02842 frizzled 9/10 Length=592 Score = 29.3 bits (64), Expect = 3.5, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 10/65 (15%) Query 14 NKILHPNVDEASGHFQGLPPYLRFWC------FLCQIYLKMTQVQISSS----RKQCDFA 63 N + H + EA+ P +++ C FLC +Y M Q+S+ R C+ A Sbjct 60 NLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQA 119 Query 64 KLLMA 68 +L A Sbjct 120 RLRCA 124 > mmu:12952 Cry1, AU020726, AU021000, Phll1; cryptochrome 1 (photolyase-like); K02295 cryptochrome Length=606 Score = 28.5 bits (62), Expect = 5.5, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Query 4 RRKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWCFLCQI-YLKMT----QVQISSSRK 58 RK + F ++ N AS GL PYLRF C C++ Y K+T +V+ +SS Sbjct 226 ERKAWVANFERPRMNANSLLASP--TGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPP 283 Query 59 QCDFAKLL 66 + +LL Sbjct 284 LSLYGQLL 291 > hsa:1407 CRY1, PHLL1; cryptochrome 1 (photolyase-like); K02295 cryptochrome Length=586 Score = 28.5 bits (62), Expect = 6.1, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Query 4 RRKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWCFLCQI-YLKMT----QVQISSSRK 58 RK + F ++ N AS GL PYLRF C C++ Y K+T +V+ +SS Sbjct 226 ERKAWVANFERPRMNANSLLASP--TGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPP 283 Query 59 QCDFAKLL 66 + +LL Sbjct 284 LSLYGQLL 291 > dre:554836 cry1b, fi26e03, wu:fi26e03, zcry1b; cryptochrome 1b Length=606 Score = 28.1 bits (61), Expect = 6.8, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query 4 RRKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWCFLCQI-YLKMTQV 51 RK + F ++ N AS GL PYLRF C C++ Y K+T + Sbjct 226 ERKAWVANFERPRMNANSLLASP--TGLSPYLRFGCLSCRLFYFKLTDL 272 Lambda K H 0.329 0.144 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2021645584 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40