bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1941_orf3 Length=68 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_037220 DNA replication licensing factor, putative (... 84.3 8e-17 pfa:PF07_0023 DNA replication licensing factor mcm7 homologue,... 62.0 5e-10 cpv:cgd4_970 DNA replication licensing factor MCM7 like AAA+ A... 54.3 8e-08 bbo:BBOV_IV007280 23.m05852; ATP dependent DNA helicase; K0221... 44.3 9e-05 bbo:BBOV_IV010040 23.m06024; DNA replication licensing factor ... 40.8 0.001 dre:192333 mcm7, chunp6911, nyz175, sr:nyz175; MCM7 minichromo... 40.8 0.001 mmu:17220 Mcm7, AI747533, Mcmd7, mCDC47; minichromosome mainte... 40.8 0.001 hsa:4176 MCM7, CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS14... 40.4 0.001 xla:397852 mcm7-a, cdc47; minichromosome maintenance complex c... 39.7 0.002 xla:380414 mcm7-b, MGC53810, cdc47, cdc47-2, mcm7, xmcm7; mini... 39.7 0.002 cpv:cgd6_240 DNA replication licensing factor MCM6-like AAA AT... 39.7 0.002 ath:AT4G02060 PRL; PRL (PROLIFERA); ATP binding / DNA binding ... 38.9 0.004 cel:F32D1.10 mcm-7; yeast MCM (licensing factor) related famil... 38.9 0.004 hsa:4173 MCM4, CDC21, CDC54, MGC33310, P1-CDC21, hCdc21; minic... 38.5 0.005 cel:Y39G10AR.14 mcm-4; yeast MCM (licensing factor) related fa... 38.5 0.005 cel:ZK632.1 mcm-6; yeast MCM (licensing factor) related family... 38.1 0.007 mmu:17217 Mcm4, 19G, AI325074, AU045576, Cdc21, KIAA4003, Mcmd... 38.1 0.007 tpv:TP01_0722 DNA replication licensing factor MCM5; K02209 mi... 38.1 0.007 tgo:TGME49_043920 DNA replication licensing factor, putative ;... 37.7 0.008 ath:AT2G16440 DNA replication licensing factor, putative; K022... 37.4 0.012 cpv:cgd7_2920 DNA replication licensing factor MCM5 like AAA+ ... 37.0 0.016 xla:373601 mcm4-a, MGC98251, cdc21; minichromosome maintenance... 36.2 0.023 cel:R10E4.4 mcm-5; yeast MCM (licensing factor) related family... 35.8 0.036 dre:337598 mcm4, cb1025, fc12c09, fj85g09, hm:zeh1616, wu:fc12... 35.4 0.040 pfa:PFL0580w DNA replication licensing factor MCM5, putative; ... 35.4 0.049 xla:397843 mcm4-b, cdc21; minichromosome maintenance complex c... 35.0 0.063 sce:YGL201C MCM6; Mcm6p; K02542 minichromosome maintenance pro... 34.7 0.068 sce:YLR274W MCM5, BOB1, CDC46; Component of the hexameric MCM ... 34.7 0.079 sce:YBR202W MCM7, CDC47; Component of the hexameric MCM comple... 34.3 0.088 pfa:PF14_0177 DNA replication licensing factor MCM2; K02540 mi... 34.3 0.097 cpv:cgd2_1100 DNA replication licensing factor MCM2 like AAA+ ... 33.5 0.18 tgo:TGME49_014970 DNA replication licensing factor, putative ;... 32.7 0.31 hsa:4175 MCM6, MCG40308, Mis5, P105MCM; minichromosome mainten... 32.3 0.37 mmu:17219 Mcm6, ASP-l1, D1Wsu22e, Mcmd6; minichromosome mainte... 32.3 0.40 xla:379699 mcm5-b, MGC68977, cdc46, xmcm5; minichromosome main... 32.3 0.43 pfa:PF13_0291 replication licensing factor, putative; K02542 m... 32.0 0.44 xla:380587 mcm5-a, MGC53425, cdc46, mcm5, xmcm5; minichromosom... 32.0 0.44 cpv:cgd2_1600 DNA replication licensing factor MCM3 like ; K02... 31.6 0.58 mmu:17216 Mcm2, AA959861, AW476101, BM28, CDCL1, Mcmd2, mKIAA0... 31.2 0.74 hsa:4171 MCM2, BM28, CCNL1, CDCL1, D3S3194, KIAA0030, MGC10606... 31.2 0.77 dre:561840 gfm1, zgc:154041; G elongation factor, mitochondria... 31.2 0.87 dre:100329673 MCM6 minichromosome maintenance deficient 6, mit... 31.2 0.94 mmu:17218 Mcm5, AA617332, AI324988, AL033333, Cdc46, Mcmd5, P1... 30.8 0.96 hsa:4174 MCM5, CDC46, MGC5315, P1-CDC46; minichromosome mainte... 30.8 0.96 xla:380282 mcm6.2-b, MGC53382, mcm6, mis5, zmcm6, zmcm6b; mini... 30.8 1.00 xla:394426 mcm6.2-a, MGC114804, mcm6.2, mcm6a-A, mis5, zMCM6, ... 30.8 1.00 tpv:TP03_0236 DNA replication licensing factor MCM7; K02210 mi... 30.4 1.3 dre:566409 mcm6, MGC158377, cb800, im:7140796, wu:fb30d05, wu:... 30.4 1.3 tpv:TP02_0532 DNA replication licensing factor MCM2; K02540 mi... 30.4 1.4 sce:YPR019W MCM4, CDC54, HCD21; Essential helicase component o... 30.4 1.4 > tgo:TGME49_037220 DNA replication licensing factor, putative (EC:6.6.1.1); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=865 Score = 84.3 bits (207), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 0/61 (0%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAA 60 F+P Q +KVQEP Q+PEADVPRTL+C L+G A+T+ LQPGM V +GGVLKPV+ G A Sbjct 313 FFLPFQEVKVQEPTCQIPEADVPRTLNCHLVGHAVTNILQPGMTVTLGGVLKPVRKMGFA 372 Query 61 A 61 A Sbjct 373 A 373 > pfa:PF07_0023 DNA replication licensing factor mcm7 homologue, putative; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=821 Score = 62.0 bits (149), Expect = 5e-10, Method: Composition-based stats. Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 FV Q IKVQE ++Q+PE D+PR+++C++ G + T +QPGM V + GVL PV G A Sbjct 288 FVKYQEIKVQELSSQLPEGDIPRSMNCIIHGES-TTSIQPGMSVTLTGVLMPVTKSGYQA 346 > cpv:cgd4_970 DNA replication licensing factor MCM7 like AAA+ ATpase ; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=857 Score = 54.3 bits (129), Expect = 8e-08, Method: Composition-based stats. Identities = 27/53 (50%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 F Q I++QEPA QVP +VPRT+ + +G T KL PGM V I GV PV Sbjct 257 FTKFQEIRIQEPADQVPTGNVPRTMKVIAMGEN-TRKLLPGMYVTISGVFLPV 308 > bbo:BBOV_IV007280 23.m05852; ATP dependent DNA helicase; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=765 Score = 44.3 bits (103), Expect = 9e-05, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 F Q ++VQEP + E ++P++L C L G LT ++PG V++ G+L PV Sbjct 253 FDKYQELRVQEPLYHLSEGELPKSLKCELFGE-LTQSVRPGDSVLMYGILLPV 304 > bbo:BBOV_IV010040 23.m06024; DNA replication licensing factor MCM5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=777 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q +K+QE A VP D+PR L L + L DK+ PG V++ GVL Sbjct 279 FVDVQTLKLQELAEDVPTGDMPRHLQ-LNVTRYLCDKMIPGDRVMVHGVL 327 > dre:192333 mcm7, chunp6911, nyz175, sr:nyz175; MCM7 minichromosome maintenance deficient 7 (S. cerevisiae); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=721 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F+ Q +++QE + QVP ++PR+++ G T QPG V + GV P+ G Sbjct 229 FIKFQELRIQEHSDQVPVGNIPRSMTIYARGEN-TRVAQPGDHVAVSGVFLPLLRSGFRQ 287 Query 62 AISCILS 68 A+ +LS Sbjct 288 AVQGLLS 294 > mmu:17220 Mcm7, AI747533, Mcmd7, mCDC47; minichromosome maintenance deficient 7 (S. cerevisiae) (EC:3.6.4.12); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=719 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 FV Q +K+QE + QVP ++PR+++ +L G T QPG V + G+ PV Sbjct 229 FVKFQEMKIQEHSDQVPVGNIPRSITVVLEGEN-TRIAQPGDHVSVTGIFLPV 280 > hsa:4176 MCM7, CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146; minichromosome maintenance complex component 7; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=719 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F+ Q +K+QE + QVP ++PR+++ L+ G T QPG V + G+ P+ G Sbjct 229 FIKFQEMKMQEHSDQVPVGNIPRSITVLVEGEN-TRIAQPGDHVSVTGIFLPILRTGFRQ 287 Query 62 AISCILS 68 + +LS Sbjct 288 VVQGLLS 294 > xla:397852 mcm7-a, cdc47; minichromosome maintenance complex component 7 (EC:3.6.4.12); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=720 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F+ Q +K+QE + QVP ++PR +S + G T QPG V I GV P+ G Sbjct 228 FIKFQELKIQEHSDQVPVGNIPRCMSVYVRGEN-TRLAQPGDHVGITGVFLPMLRTGFRQ 286 Query 62 AISCILS 68 + +LS Sbjct 287 VVQGLLS 293 > xla:380414 mcm7-b, MGC53810, cdc47, cdc47-2, mcm7, xmcm7; minichromosome maintenance complex component 7 (EC:3.6.4.12); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=720 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F+ Q +K+QE + QVP ++PR +S + G T QPG V I GV P+ G Sbjct 228 FIKFQELKIQEHSDQVPVGNIPRCMSVYVRGEN-TRLAQPGDHVGITGVFLPMLRTGFRQ 286 Query 62 AISCILS 68 + +LS Sbjct 287 VVQGLLS 293 > cpv:cgd6_240 DNA replication licensing factor MCM6-like AAA ATpase ; K02542 minichromosome maintenance protein 6 Length=1055 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 Q +++QE A ++P +PR+++ +L G DK +PG +VI G+L Sbjct 228 QKLRIQEHATEIPPGSMPRSMNVILRGD-FVDKCKPGDKVIFTGML 272 > ath:AT4G02060 PRL; PRL (PROLIFERA); ATP binding / DNA binding / DNA-dependent ATPase/ nucleoside-triphosphatase/ nucleotide binding; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=716 Score = 38.9 bits (89), Expect = 0.004, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F+ Q K+QE A VP+ +PR+++ L G LT K+ PG V G+ P+ G A Sbjct 223 FLKFQEAKMQELAEHVPKGHIPRSMTVHLRGE-LTRKVSPGDVVEFSGIFLPIPYTGFKA 281 > cel:F32D1.10 mcm-7; yeast MCM (licensing factor) related family member (mcm-7); K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=730 Score = 38.9 bits (89), Expect = 0.004, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYG 58 FV Q +K+QE + QVP +PRT++ + G +T K G V + GV P+ G Sbjct 242 FVKFQELKIQELSEQVPVGSIPRTMTVHVYGE-MTRKCNTGNVVHVSGVFLPIMQSG 297 > hsa:4173 MCM4, CDC21, CDC54, MGC33310, P1-CDC21, hCdc21; minichromosome maintenance complex component 4; K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=863 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 LF Q+IK+QE +P P T+ L + L DK+QPG V + G+ + V Sbjct 345 LFSDKQMIKLQESPEDMPAGQTPHTV-ILFAHNDLVDKVQPGDRVNVTGIYRAV 397 > cel:Y39G10AR.14 mcm-4; yeast MCM (licensing factor) related family member (mcm-4); K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=823 Score = 38.5 bits (88), Expect = 0.005, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 +F+ QV+K+QE +P + P T+S GS L + +QPG + + G+ + Sbjct 308 VFLDKQVVKLQESPDDMPSGETPHTVSVYAHGS-LVESVQPGDRITVTGIFR 358 > cel:ZK632.1 mcm-6; yeast MCM (licensing factor) related family member (mcm-6); K02542 minichromosome maintenance protein 6 Length=810 Score = 38.1 bits (87), Expect = 0.007, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q I++QE A++P +PRT+ ++ G + + +QPG + I G L Sbjct 199 FVDFQKIRIQETQAELPRGSIPRTVDVIVRGE-MVETVQPGDKCDIVGTL 247 > mmu:17217 Mcm4, 19G, AI325074, AU045576, Cdc21, KIAA4003, Mcmd4, mKIAA4003, mcdc21; minichromosome maintenance deficient 4 homolog (S. cerevisiae) (EC:3.6.4.12); K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=862 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 F Q+IK+QE +P P T+ L + L DK+QPG V + G+ + V Sbjct 344 FFSDKQMIKLQESPEDMPAGQTPHTI-VLFAHNDLVDKVQPGDRVNVTGIYRAV 396 > tpv:TP01_0722 DNA replication licensing factor MCM5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=767 Score = 38.1 bits (87), Expect = 0.007, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q++K+QE A VP D+PR L L + L DK+ PG + GVL Sbjct 273 FVDVQLLKMQELAEDVPTGDMPRHLQ-LNVTRYLCDKVIPGDRIYAHGVL 321 > tgo:TGME49_043920 DNA replication licensing factor, putative ; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=794 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Query 2 FVPSQVIKVQEPAAQVPEADVPRT--LSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q +K+QE VP D+PR L+C L LTD+ PG +II GVL Sbjct 286 FVDVQSLKLQELPEDVPTGDMPRHLLLNCTRL---LTDQAFPGDRLIIHGVL 334 > ath:AT2G16440 DNA replication licensing factor, putative; K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=847 Score = 37.4 bits (85), Expect = 0.012, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 F Q++++QE ++PE P T+S LLL L D +PG + + G+ + Sbjct 314 FADKQIVRLQETPDEIPEGGTPHTVS-LLLHDKLVDNGKPGDRIEVTGIYR 363 > cpv:cgd7_2920 DNA replication licensing factor MCM5 like AAA+ ATpase ; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=791 Score = 37.0 bits (84), Expect = 0.016, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 ++ Q +K QE VP D+PR +S L + L DK+ PG + + GVL Sbjct 270 YIDIQSMKFQELPEHVPTGDIPRNIS-LHMTRGLIDKVIPGNRLYVVGVL 318 > xla:373601 mcm4-a, MGC98251, cdc21; minichromosome maintenance complex component 4 (EC:3.6.4.12); K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=858 Score = 36.2 bits (82), Expect = 0.023, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQL 56 +F Q+IK+QE +P P T + L + L DK+QPG V + G+ + V + Sbjct 340 MFSDKQMIKLQESPGDMPAGQTPHT-TILYAHNDLVDKVQPGDRVNVTGIYRAVPI 394 > cel:R10E4.4 mcm-5; yeast MCM (licensing factor) related family member (mcm-5); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=759 Score = 35.8 bits (81), Expect = 0.036, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query 3 VPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 V Q +K+QE VP ++PR L L LTDK+ PG V I GV Sbjct 223 VDYQTLKLQENPEDVPHGEMPRHLQ-LFTERYLTDKVVPGNRVTIVGV 269 > dre:337598 mcm4, cb1025, fc12c09, fj85g09, hm:zeh1616, wu:fc12c09, wu:fj85g09, zeh1616; MCM4 minichromosome maintenance deficient 4, mitotin (S. cerevisiae); K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=845 Score = 35.4 bits (80), Expect = 0.040, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK--PVQL 56 +F Q+IK+QE +P P T + + + L DK+QPG V I G+ + P++L Sbjct 327 VFSDKQMIKLQESPEDMPAGQTPHT-TVVYAHNDLVDKVQPGDRVNITGIYRAAPMRL 383 > pfa:PFL0580w DNA replication licensing factor MCM5, putative; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=758 Score = 35.4 bits (80), Expect = 0.049, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q +K+QE VP D+PR L L + L +K+ PG V + GVL Sbjct 262 FVDIQSLKMQELPEAVPTGDMPRHLQ-LNVTRYLCEKMIPGDRVYVHGVL 310 > xla:397843 mcm4-b, cdc21; minichromosome maintenance complex component 4 (EC:3.6.4.12); K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=863 Score = 35.0 bits (79), Expect = 0.063, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQL 56 +F Q+IK+QE +P P T + L + L DK+QPG V + G+ + V + Sbjct 345 MFSDKQMIKLQESPEDMPAGQTPHT-TILYGHNDLVDKVQPGDRVNVTGIYRAVPI 399 > sce:YGL201C MCM6; Mcm6p; K02542 minichromosome maintenance protein 6 Length=1017 Score = 34.7 bits (78), Expect = 0.068, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 F+ Q +++QE A ++P +PRTL +L G ++ ++ +PG GV Sbjct 353 FLDWQKVRIQENANEIPTGSMPRTLDVILRGDSV-ERAKPGDRCKFTGV 400 > sce:YLR274W MCM5, BOB1, CDC46; Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=775 Score = 34.7 bits (78), Expect = 0.079, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 F+ Q +K+QE VP ++PR L+ + LT+K+ PG V I G+ Sbjct 250 FIDQQFLKLQEIPELVPVGEMPRNLT-MTCDRYLTNKVIPGTRVTIVGI 297 > sce:YBR202W MCM7, CDC47; Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=845 Score = 34.3 bits (77), Expect = 0.088, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQLYGAAA 61 F Q K+QE + QVP +PR+L+ + G+ L L PG V + G+ P G A Sbjct 307 FSAFQECKIQELSQQVPVGHIPRSLNIHVNGT-LVRSLSPGDIVDVTGIFLPAPYTGFKA 365 Query 62 AISCILS 68 + +L+ Sbjct 366 LKAGLLT 372 > pfa:PF14_0177 DNA replication licensing factor MCM2; K02540 minichromosome maintenance protein 2 Length=971 Score = 34.3 bits (77), Expect = 0.097, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 Q I +QE VP PR ++ G L DK++PG EV + G+ K Sbjct 388 QKITLQESPCSVPAGRAPRQREVVVTGD-LVDKVKPGEEVEVLGIYK 433 > cpv:cgd2_1100 DNA replication licensing factor MCM2 like AAA+ ATpase ; K02540 minichromosome maintenance protein 2 Length=970 Score = 33.5 bits (75), Expect = 0.18, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 Q + +QE VP VPR+ ++ G L D PG E+I+ G+ + Sbjct 403 QKLTIQESPGSVPAGRVPRSREIIVSGD-LVDYACPGEEIIVTGIYR 448 > tgo:TGME49_014970 DNA replication licensing factor, putative ; K02540 minichromosome maintenance protein 2 Length=1049 Score = 32.7 bits (73), Expect = 0.31, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 FV Q + +QE +VP PR ++ G L D ++PG EV + G+ + Sbjct 433 FVDFQRLTLQESPGKVPPGRPPRQREVIITGE-LVDSIKPGEEVDVLGIYQ 482 > hsa:4175 MCM6, MCG40308, Mis5, P105MCM; minichromosome maintenance complex component 6; K02542 minichromosome maintenance protein 6 Length=821 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q +++QE A++P +PR+L +L A+ + Q G + G L Sbjct 200 FVDFQKVRIQETQAELPRGSIPRSLEVILRAEAV-ESAQAGDKCDFTGTL 248 > mmu:17219 Mcm6, ASP-l1, D1Wsu22e, Mcmd6; minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (EC:3.6.4.12); K02542 minichromosome maintenance protein 6 Length=821 Score = 32.3 bits (72), Expect = 0.40, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSAL 35 FV Q +++QE A++P +PR+L +L A+ Sbjct 200 FVDFQKVRIQETQAELPRGSIPRSLEVILRAEAV 233 > xla:379699 mcm5-b, MGC68977, cdc46, xmcm5; minichromosome maintenance complex component 5 (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=735 Score = 32.3 bits (72), Expect = 0.43, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q +K+QE VP ++PR + L L DK+ PG V I G+ Sbjct 226 QTLKLQESPDAVPHGELPRHMQ-LYCDRYLCDKVVPGNRVTIMGI 269 > pfa:PF13_0291 replication licensing factor, putative; K02542 minichromosome maintenance protein 6 Length=929 Score = 32.0 bits (71), Expect = 0.44, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVL 51 FV Q I++QE A + P +PR + ++L + + D + G +I+ G L Sbjct 287 FVDWQKIRLQEIAQESPPGSMPRNMD-VILRNDIVDSVHAGDRIIVTGCL 335 > xla:380587 mcm5-a, MGC53425, cdc46, mcm5, xmcm5; minichromosome maintenance complex component 5 (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=735 Score = 32.0 bits (71), Expect = 0.44, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q +K+QE VP ++PR + L L DK+ PG V I G+ Sbjct 226 QTLKLQESPDAVPHGELPRHMQ-LYCDRYLCDKVVPGNRVTIMGI 269 > cpv:cgd2_1600 DNA replication licensing factor MCM3 like ; K02541 minichromosome maintenance protein 3 Length=862 Score = 31.6 bits (70), Expect = 0.58, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query 5 SQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPV 54 +Q + +QE +P +PR++ ++ L + ++PG V I GV KP+ Sbjct 213 TQKMTLQELPEMIPTGQLPRSIE-IIAEDDLVETIKPGDRVKIVGVYKPI 261 > mmu:17216 Mcm2, AA959861, AW476101, BM28, CDCL1, Mcmd2, mKIAA0030; minichromosome maintenance deficient 2 mitotin (S. cerevisiae) (EC:3.6.4.12); K02540 minichromosome maintenance protein 2 Length=904 Score = 31.2 bits (69), Expect = 0.74, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q I++QE +V +PR+ +LL L D +PG E+ + G+ Sbjct 374 QRIRIQESPGKVAAGRLPRSKDAILLAD-LVDSCKPGDEIELTGI 417 > hsa:4171 MCM2, BM28, CCNL1, CDCL1, D3S3194, KIAA0030, MGC10606, MITOTIN, cdc19; minichromosome maintenance complex component 2; K02540 minichromosome maintenance protein 2 Length=904 Score = 31.2 bits (69), Expect = 0.77, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q I++QE +V +PR+ +LL L D +PG E+ + G+ Sbjct 374 QRIRIQESPGKVAAGRLPRSKDAILLAD-LVDSCKPGDEIELTGI 417 > dre:561840 gfm1, zgc:154041; G elongation factor, mitochondrial 1; K02355 elongation factor G Length=745 Score = 31.2 bits (69), Expect = 0.87, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query 1 LFVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDK-LQPGMEVIIGGVLKPVQLYGA 59 +F+ +V V + A V A V R+ S +L+GSAL +K +QP ++ ++ + P ++ Sbjct 262 MFLEERVPTVLDLKAAVRRATVKRSFSPVLVGSALKNKGVQPLLDAVLEYLPNPTEVQNY 321 Query 60 A 60 A Sbjct 322 A 322 > dre:100329673 MCM6 minichromosome maintenance deficient 6, mitotin-like; K02542 minichromosome maintenance protein 6 Length=830 Score = 31.2 bits (69), Expect = 0.94, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSAL 35 F+ Q +++QE A++P +PR++ +L A+ Sbjct 198 FIDFQKVRIQETQAELPRGSIPRSMEVILRAEAV 231 > mmu:17218 Mcm5, AA617332, AI324988, AL033333, Cdc46, Mcmd5, P1-CDC46, mCD46, mCDC46; minichromosome maintenance deficient 5, cell division cycle 46 (S. cerevisiae) (EC:3.6.4.12); K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=734 Score = 30.8 bits (68), Expect = 0.96, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q +K+QE VP ++PR + L L DK+ PG V I G+ Sbjct 225 QTLKLQELPDAVPHGEMPRHMQ-LYCDRYLCDKVVPGNRVTIMGI 268 > hsa:4174 MCM5, CDC46, MGC5315, P1-CDC46; minichromosome maintenance complex component 5; K02209 minichromosome maintenance protein 5 (cell division control protein 46) Length=734 Score = 30.8 bits (68), Expect = 0.96, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGV 50 Q +K+QE VP ++PR + L L DK+ PG V I G+ Sbjct 225 QTLKLQELPDAVPHGEMPRHMQ-LYCDRYLCDKVVPGNRVTIMGI 268 > xla:380282 mcm6.2-b, MGC53382, mcm6, mis5, zmcm6, zmcm6b; minichromosome maintenance complex component 6 (EC:3.6.4.12); K02542 minichromosome maintenance protein 6 Length=825 Score = 30.8 bits (68), Expect = 1.00, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSAL 35 FV Q +++QE A++P +PR++ +L A+ Sbjct 201 FVDFQKVRIQETQAELPRGSIPRSVEVILRAEAV 234 > xla:394426 mcm6.2-a, MGC114804, mcm6.2, mcm6a-A, mis5, zMCM6, zmcm6-A, zmcm6a; minichromosome maintenance complex component 6 (EC:3.6.4.12) Length=823 Score = 30.8 bits (68), Expect = 1.00, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSAL 35 FV Q +++QE A++P +PR++ +L A+ Sbjct 201 FVDFQKVRIQETQAELPRGSIPRSVEVILRAEAV 234 > tpv:TP03_0236 DNA replication licensing factor MCM7; K02210 minichromosome maintenance protein 7 (cell division control protein 47) Length=693 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 26/79 (32%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSC--------------------------LLLGSAL 35 F Q I+VQEP + E ++P+ L C ++L L Sbjct 94 FEKYQEIRVQEPLVHLNEGEMPKNLKCQLTIYPAIYYWGSGPSSSVTLVTSIIIMLLDTL 153 Query 36 TDKLQPGMEVIIGGVLKPV 54 L+PG +++ G+L P+ Sbjct 154 VGLLRPGDNILLYGILLPM 172 > dre:566409 mcm6, MGC158377, cb800, im:7140796, wu:fb30d05, wu:fc26f09; MCM6 minichromosome maintenance deficient 6, mitotin (S. cerevisiae); K02542 minichromosome maintenance protein 6 Length=830 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSAL 35 F+ Q +++QE A++P +PR++ +L A+ Sbjct 198 FIDFQKLRIQETQAELPRGSIPRSMEVILRAEAV 231 > tpv:TP02_0532 DNA replication licensing factor MCM2; K02540 minichromosome maintenance protein 2 Length=967 Score = 30.4 bits (67), Expect = 1.4, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query 6 QVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLK 52 Q + +QEP + VP PR +L G D ++PG V + G K Sbjct 379 QKLTIQEPPSSVPAGRTPRQKIVILTGD-FVDSVKPGDLVDVLGTYK 424 > sce:YPR019W MCM4, CDC54, HCD21; Essential helicase component of heterohexameric MCM2-7 complexes which bind pre-replication complexes on DNA and melt the DNA prior to replication; accumulates in the nucleus in G1; homolog of S. pombe Cdc21p; K02212 minichromosome maintenance protein 4 (cell division control protein 54) Length=933 Score = 30.4 bits (67), Expect = 1.4, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query 2 FVPSQVIKVQEPAAQVPEADVPRTLSCLLLGSALTDKLQPGMEVIIGGVLKPVQL 56 F QVIK+QE VP+ P ++S L + L D + G + + G + + + Sbjct 391 FADKQVIKLQETPDFVPDGQTPHSIS-LCVYDELVDSCRAGDRIEVTGTFRSIPI 444 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2033830404 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40