bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1839_orf2 Length=83 Score E Sequences producing significant alignments: (Bits) Value pfa:PF13_0324 Sec24 subunit, putative 65.5 4e-11 tgo:TGME49_077000 transport protein Sec24, putative (EC:3.1.3.48) 64.7 7e-11 hsa:10427 SEC24B, MGC48822, SEC24; SEC24 family, member B (S. ... 64.3 9e-11 hsa:10802 SEC24A; SEC24 family, member A (S. cerevisiae); K140... 63.9 1e-10 mmu:99683 Sec24b, AI605202, SEC24; Sec24 related gene family, ... 63.9 1e-10 dre:100000526 sec24-like; K14007 protein transport protein SEC24 63.5 2e-10 dre:334633 fa16f04; wu:fa16f04 62.8 3e-10 mmu:77371 Sec24a, 9430090N21Rik, AI504915; Sec24 related gene ... 62.4 4e-10 cpv:cgd8_4470 hypothetical protein ; K14007 protein transport ... 60.8 1e-09 ath:AT4G32640 protein binding / zinc ion binding; K14007 prote... 59.7 3e-09 ath:AT3G44340 CEF; CEF (clone eighty-four); protein binding / ... 57.0 1e-08 ath:AT3G07100 protein transport protein Sec24, putative; K1400... 55.8 3e-08 xla:447693 sec24d, MGC80413; SEC24 family, member D; K14007 pr... 52.0 4e-07 hsa:9632 SEC24C, KIAA0079; SEC24 family, member C (S. cerevisi... 52.0 5e-07 bbo:BBOV_IV000740 21.m02727; Sec 24 protein transport protein 51.6 6e-07 mmu:218811 Sec24c, 2610204K03Rik, mKIAA0079; Sec24 related gen... 51.2 8e-07 hsa:9871 SEC24D, FLJ43974, KIAA0755; SEC24 family, member D (S... 50.4 1e-06 tpv:TP01_0099 vesicle transport protein 49.7 2e-06 mmu:69608 Sec24d, 2310020L09Rik, Gm1349; Sec24 related gene fa... 48.5 5e-06 dre:553407 sec24d; SEC24 family, member D (S. cerevisiae); K14... 47.8 9e-06 dre:571870 sec24c, fd10d12, wu:fd10d12; SEC24 family, member C... 47.0 1e-05 dre:100333371 yeast SEC homolog family member (sec-24.1)-like 45.4 4e-05 cel:F12F6.6 sec-24.1; yeast SEC homolog family member (sec-24.... 43.9 1e-04 sce:YHR098C SFB3, LST1; Component of the Sec23p-Sfb3p heterodi... 37.7 0.008 cel:ZC518.2 sec-24.2; yeast SEC homolog family member (sec-24.... 37.7 0.008 sce:YIL109C SEC24, ANU1; Component of the Sec23p-Sec24p hetero... 35.4 0.040 pfa:PFL1865w conserved Plasmodium protein 33.9 0.13 sce:YNL049C SFB2, ISS1; Component of the Sec23p-Sfb2p heterodi... 30.4 1.6 dre:449925 slc27a2, MGC112376, im:7139614, wu:fb99g05, zgc:112... 29.3 3.5 sce:YDR514C Putative protein of unknown function 28.5 5.2 tgo:TGME49_080600 histidyl-tRNA synthetase, putative (EC:4.3.1... 28.5 5.6 > pfa:PF13_0324 Sec24 subunit, putative Length=940 Score = 65.5 bits (158), Expect = 4e-11, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 46/65 (70%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 TL ++T+DS++HFY L ++ + ++ VVP +QDIF+PL E++ V +HEC+ I L+ Sbjct 364 TLIGIMTFDSTIHFYNLNSNLKQTQMMVVPDIQDIFIPLPEDILVNVHECQNVIDVLLDN 423 Query 61 IPDIF 65 +P ++ Sbjct 424 LPGMW 428 > tgo:TGME49_077000 transport protein Sec24, putative (EC:3.1.3.48) Length=1019 Score = 64.7 bits (156), Expect = 7e-11, Method: Composition-based stats. Identities = 29/71 (40%), Positives = 51/71 (71%), Gaps = 4/71 (5%) Query 1 TLAAVLTYDSSVHFYRLEAS----QTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILN 56 T+ ++TYDS+VHFY L ++ + RP++ V+P++ D+FLPL+++LFV E ++A+L Sbjct 355 TMVGIVTYDSAVHFYALGSASGGGKRRPQVLVMPEIDDVFLPLSDDLFVNFAENRDAVLE 414 Query 57 TLNAIPDIFFS 67 L+ IP ++ S Sbjct 415 ALDTIPSLWRS 425 > hsa:10427 SEC24B, MGC48822, SEC24; SEC24 family, member B (S. cerevisiae); K14007 protein transport protein SEC24 Length=1233 Score = 64.3 bits (155), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ ++P++ +V + D+FLP ++L V L+E KE I + LNA Sbjct 681 TRIGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNA 740 Query 61 IPDIF 65 +P++F Sbjct 741 LPNMF 745 > hsa:10802 SEC24A; SEC24 family, member A (S. cerevisiae); K14007 protein transport protein SEC24 Length=1093 Score = 63.9 bits (154), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 25/65 (38%), Positives = 45/65 (69%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ S ++P++ +V ++D+F+P+ ENL V L+E KE + + L Sbjct 542 TKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKT 601 Query 61 IPDIF 65 +P +F Sbjct 602 LPQMF 606 > mmu:99683 Sec24b, AI605202, SEC24; Sec24 related gene family, member B (S. cerevisiae); K14007 protein transport protein SEC24 Length=1251 Score = 63.9 bits (154), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 26/67 (38%), Positives = 45/67 (67%), Gaps = 0/67 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ ++P++ +V + D+FLP ++L V L+E KE I + LNA Sbjct 699 TRIGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNA 758 Query 61 IPDIFFS 67 +P +F + Sbjct 759 LPSMFIN 765 > dre:100000526 sec24-like; K14007 protein transport protein SEC24 Length=1097 Score = 63.5 bits (153), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 44/65 (67%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ +RP++ +V + D+FLP + L V L+ECKE + + L++ Sbjct 545 TKIGFITFDSTIHFYSLQEGLSRPQMLIVSDIDDVFLPTQDGLLVNLNECKELVQDLLSS 604 Query 61 IPDIF 65 +P ++ Sbjct 605 LPQMW 609 > dre:334633 fa16f04; wu:fa16f04 Length=768 Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 27/73 (36%), Positives = 49/73 (67%), Gaps = 1/73 (1%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ ++P++ VV ++D+F+P ++L V L E KE + + LNA Sbjct 317 TRIGFVTFDSTIHFYNLQEGLSQPQMLVVSDIEDVFIPTHDSLLVNLKESKELVKDLLNA 376 Query 61 IPDIFFSKAKRTR 73 +P + FS+ + T+ Sbjct 377 LPGM-FSQTRETQ 388 > mmu:77371 Sec24a, 9430090N21Rik, AI504915; Sec24 related gene family, member A (S. cerevisiae); K14007 protein transport protein SEC24 Length=1090 Score = 62.4 bits (150), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 43/65 (66%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +T+DS++HFY L+ ++P++ +V + D+F+P+ ENL V L+E KE + + L Sbjct 539 TKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIDDVFIPMPENLLVNLNESKELVQDLLKT 598 Query 61 IPDIF 65 +P +F Sbjct 599 LPQMF 603 > cpv:cgd8_4470 hypothetical protein ; K14007 protein transport protein SEC24 Length=874 Score = 60.8 bits (146), Expect = 1e-09, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 45/64 (70%), Gaps = 0/64 (0%) Query 2 LAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAI 61 + ++T+DSS+HFY L ++ ++P +FVV + D+FLPL+E + V + + E I N L+ + Sbjct 315 MIGIITFDSSIHFYDLNSNLSQPHMFVVSDLNDLFLPLSEGVLVNIADSTEQITNLLDNL 374 Query 62 PDIF 65 P+++ Sbjct 375 PNLW 378 > ath:AT4G32640 protein binding / zinc ion binding; K14007 protein transport protein SEC24 Length=1080 Score = 59.7 bits (143), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 43/65 (66%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T + T+DS++HFY L+ + +P + +VP VQD++ PL ++ V L EC++ + L++ Sbjct 543 TFVGIATFDSTIHFYNLKRALQQPLMLIVPDVQDVYTPLETDVVVQLSECRQHLELLLDS 602 Query 61 IPDIF 65 IP +F Sbjct 603 IPTMF 607 > ath:AT3G44340 CEF; CEF (clone eighty-four); protein binding / transporter/ zinc ion binding Length=1069 Score = 57.0 bits (136), Expect = 1e-08, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 42/65 (64%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T + T+DS++HFY L+ + +P + +VP VQD++ PL ++ V L EC++ + L + Sbjct 546 TFVGIATFDSTIHFYNLKRALQQPLMLIVPDVQDVYTPLETDVIVQLSECRQHLEILLES 605 Query 61 IPDIF 65 IP +F Sbjct 606 IPTMF 610 > ath:AT3G07100 protein transport protein Sec24, putative; K14007 protein transport protein SEC24 Length=1038 Score = 55.8 bits (133), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 44/65 (67%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 T +TYDS++HFY +++S ++P++ VV + DIF+PL ++L V L E + + L++ Sbjct 484 TQIGFITYDSTLHFYNMKSSLSQPQMMVVSDLDDIFVPLPDDLLVNLSESRTVVDAFLDS 543 Query 61 IPDIF 65 +P +F Sbjct 544 LPLMF 548 > xla:447693 sec24d, MGC80413; SEC24 family, member D; K14007 protein transport protein SEC24 Length=1126 Score = 52.0 bits (123), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 40/62 (64%), Gaps = 0/62 (0%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 +TY+ +HFY +++S +P++ VV V D+F+PL + V ++E + I + L+ IP+ Sbjct 580 GFVTYNKVLHFYNVKSSLAQPQMMVVSDVSDMFVPLLDGFLVNVNESRTVITSLLDQIPE 639 Query 64 IF 65 +F Sbjct 640 LF 641 > hsa:9632 SEC24C, KIAA0079; SEC24 family, member C (S. cerevisiae); K14007 protein transport protein SEC24 Length=1094 Score = 52.0 bits (123), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 40/62 (64%), Gaps = 0/62 (0%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 +TY+ +HFY +++S +P++ VV V D+F+PL + V ++E + I + L+ IP+ Sbjct 548 GFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITSLLDQIPE 607 Query 64 IF 65 +F Sbjct 608 MF 609 > bbo:BBOV_IV000740 21.m02727; Sec 24 protein transport protein Length=835 Score = 51.6 bits (122), Expect = 6e-07, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 40/62 (64%), Gaps = 0/62 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 TL ++T+D+SVH Y++ + + P + ++ + D+FLPL + + L+E + IL+ L+ Sbjct 294 TLVGIMTFDTSVHIYQMNSGGSSPNILMLSDLNDLFLPLPNGILLNLYESESEILDLLSL 353 Query 61 IP 62 +P Sbjct 354 LP 355 > mmu:218811 Sec24c, 2610204K03Rik, mKIAA0079; Sec24 related gene family, member C (S. cerevisiae); K14007 protein transport protein SEC24 Length=1020 Score = 51.2 bits (121), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 0/62 (0%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 +TY+ +HFY +++S +P++ VV V D+F+PL + V + E + I + L+ IP+ Sbjct 474 GFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVSESRAVITSLLDQIPE 533 Query 64 IF 65 +F Sbjct 534 MF 535 > hsa:9871 SEC24D, FLJ43974, KIAA0755; SEC24 family, member D (S. cerevisiae); K14007 protein transport protein SEC24 Length=1032 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 0/62 (0%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 +TY+ +HF+ ++++ +P++ VV V ++F+PL + V E + I N L+ IPD Sbjct 486 GFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPD 545 Query 64 IF 65 +F Sbjct 546 MF 547 > tpv:TP01_0099 vesicle transport protein Length=899 Score = 49.7 bits (117), Expect = 2e-06, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 0/65 (0%) Query 1 TLAAVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNA 60 TL ++T+DS+VHFY++ +L +V ++D+FLPL + + L E + L L+ Sbjct 349 TLVGLMTFDSTVHFYQISKGPQNYQLLIVSDLEDLFLPLPGEVLLNLQESSQDFLRMLDL 408 Query 61 IPDIF 65 +P ++ Sbjct 409 LPSLW 413 > mmu:69608 Sec24d, 2310020L09Rik, Gm1349; Sec24 related gene family, member D (S. cerevisiae); K14007 protein transport protein SEC24 Length=1032 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 38/62 (61%), Gaps = 0/62 (0%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 +TY+ +HF+ ++++ +P++ VV V ++F+PL + V E + I N L+ IP+ Sbjct 486 GFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYEESQSVIHNLLDQIPE 545 Query 64 IF 65 +F Sbjct 546 MF 547 > dre:553407 sec24d; SEC24 family, member D (S. cerevisiae); K14007 protein transport protein SEC24 Length=1029 Score = 47.8 bits (112), Expect = 9e-06, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 37/60 (61%), Gaps = 0/60 (0%) Query 6 LTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPDIF 65 +TY+ +HFY ++++ +P++ VV ++F+PL + V E + I N L+ IPD+F Sbjct 485 VTYNKILHFYNVKSALAQPQMMVVSDTAEMFVPLLDGFLVNFQESRAVINNLLDQIPDMF 544 > dre:571870 sec24c, fd10d12, wu:fd10d12; SEC24 family, member C (S. cerevisiae); K14007 protein transport protein SEC24 Length=1315 Score = 47.0 bits (110), Expect = 1e-05, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 0/60 (0%) Query 6 LTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPDIF 65 +TY+ +HFY ++AS +P++ VV V D+F+PL + V + E + I + L+ IP++F Sbjct 773 VTYNKVLHFYNVKASLAQPQMLVVSDVADMFVPLLDGFLVNVSESRVVIESLLDQIPEMF 832 > dre:100333371 yeast SEC homolog family member (sec-24.1)-like Length=911 Score = 45.4 bits (106), Expect = 4e-05, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 0/60 (0%) Query 6 LTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPDIF 65 +TY+ +HFY ++AS +P++ VV V D+F+PL + V + E + I + L+ IP++F Sbjct 702 VTYNKVLHFYNVKASLAQPQMLVVSDVADMFVPLLDGFLVNVSESRVVIESLLDQIPEMF 761 > cel:F12F6.6 sec-24.1; yeast SEC homolog family member (sec-24.1); K14007 protein transport protein SEC24 Length=1126 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 + T+D +VHF+ + S P++ V+ VQ+ F+P+ + L +P +E + L IP Sbjct 580 GLATFDQAVHFFDI--SSASPKMLVMSDVQEPFVPMVDGLLLPYNEALPGLRAALAEIPK 637 Query 64 IFFSKAKRTR 73 + FS++K T Sbjct 638 L-FSQSKTTE 646 > sce:YHR098C SFB3, LST1; Component of the Sec23p-Sfb3p heterodimer of the COPII vesicle coat, required for cargo selection during vesicle formation in ER to Golgi transport; homologous to Sec24p and Sfb2p Length=929 Score = 37.7 bits (86), Expect = 0.008, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Query 4 AVLTYDSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPD 63 A++ YD+ + F+ L + ++V ++ D+FLP LFV + I +TL I Sbjct 339 AIIVYDNKLRFFNLRPDLDNAQEYIVSELDDVFLPFYNGLFVKPGNSMKIINDTLIKISG 398 Query 64 IFFSKAKRTRLPPPC 78 + S K + +P C Sbjct 399 -YISTDKYSHVPQVC 412 > cel:ZC518.2 sec-24.2; yeast SEC homolog family member (sec-24.2); K14007 protein transport protein SEC24 Length=984 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 0/57 (0%) Query 9 DSSVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPDIF 65 D +HF+ +++ P +V + D FLP +L VP+ + K+ I + +P+ + Sbjct 452 DQCLHFFSFSSNKRYPNEMIVDDIDDAFLPSVTSLLVPMKKFKDTIRTFIKQLPEFY 508 > sce:YIL109C SEC24, ANU1; Component of the Sec23p-Sec24p heterodimer of the COPII vesicle coat, required for cargo selection during vesicle formation in ER to Golgi transport; homologous to Sfb2p and Sfb3p; K14007 protein transport protein SEC24 Length=926 Score = 35.4 bits (80), Expect = 0.040, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Query 1 TLAAVLTYDSSVHFYRL-------EASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEA 53 T ++L D+++H++++ E S + + + +++ FLP ++ V L C++ Sbjct 343 TRISILCVDNAIHYFKIPLDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQN 402 Query 54 ILNTLNAIPDIFFSK 68 I L IP IF S Sbjct 403 IETLLTKIPQIFQSN 417 > pfa:PFL1865w conserved Plasmodium protein Length=1812 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 41 ENLFVPLHECKEAILNTLNAIPDIFF 66 E LF+ ++EC + I N +N IP++FF Sbjct 465 ELLFISMNECNKKIYNEINKIPELFF 490 > sce:YNL049C SFB2, ISS1; Component of the Sec23p-Sfb2p heterodimer of the COPII vesicle coat, required for cargo selection during vesicle formation in ER to Golgi transport; homologous to Sec24p and Sfb3p Length=876 Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query 25 RLFVVPQVQDIFLPL-AENLFVPLHECKEAILNTLNAIPDIF 65 ++F + + + FLP+ ++ L VPL CK + L IP+IF Sbjct 329 QMFDIGDLDEPFLPMPSDELVVPLKYCKNNLETLLKKIPEIF 370 > dre:449925 slc27a2, MGC112376, im:7139614, wu:fb99g05, zgc:112376; solute carrier family 27 (fatty acid transporter), member 2 (EC:6.2.1.-) Length=614 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 20 SQTRPRLFVVPQVQDIFLPLAENLF 44 + TR RLF++ + Q F+PL E +F Sbjct 580 NSTRDRLFIMEENQQTFVPLTEEIF 604 > sce:YDR514C Putative protein of unknown function Length=483 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query 11 SVHFYRLEASQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLN 59 S H EA R + FV +D FL L E+L +PL +C E I + +N Sbjct 239 SYHLIVAEALPLRNKKFVC-DFKDCFL-LGESLVLPLEQCVEFIQSLIN 285 > tgo:TGME49_080600 histidyl-tRNA synthetase, putative (EC:4.3.1.3 6.1.1.21); K01892 histidyl-tRNA synthetase [EC:6.1.1.21] Length=1116 Score = 28.5 bits (62), Expect = 5.6, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 9/57 (15%) Query 20 SQTRPRLFVVPQVQDIFLPLAENLFVPLHECKEAILNTLNAIPDIFFSKAKRTRLPP 76 S+ RLFV ++ + V L +C A+L +P FFS +R RLPP Sbjct 175 SEVAGRLFVASRLLSVL--------VTLQDCNAALLTEALLVPTDFFSHQQR-RLPP 222 Lambda K H 0.325 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2044675024 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40