bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1682_orf1 Length=53 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_092220 26S proteasome non-ATPase regulatory subunit... 67.4 1e-11 pfa:MAL13P1.190 proteasome regulatory component, putative; K03... 49.3 3e-06 bbo:BBOV_II001520 18.m06117; 26S proteasome non-ATPase regulat... 49.3 3e-06 xla:444384 psmd3, MGC82894; proteasome (prosome, macropain) 26... 47.8 9e-06 dre:393544 psmd3, MGC65867, zgc:65867, zgc:77369; proteasome (... 47.4 1e-05 mmu:22123 Psmd3, AI255837, AntP91a, D11Bwg1349e, Psd3, Tstap91... 47.4 1e-05 hsa:5709 PSMD3, P58, RPN3, S3, TSTA2; proteasome (prosome, mac... 47.4 1e-05 tpv:TP04_0438 proteasome regulatory component; K03033 26S prot... 46.2 2e-05 cpv:cgd8_4060 26S proteasomal subunit S3; PINT domain containi... 45.8 3e-05 cel:C30C11.2 rpn-3; proteasome Regulatory Particle, Non-ATPase... 45.4 4e-05 sce:YER021W RPN3, SUN2; Essential, non-ATPase regulatory subun... 42.4 3e-04 ath:AT1G75990 26S proteasome regulatory subunit S3, putative (... 40.4 0.001 ath:AT1G20200 EMB2719 (EMBRYO DEFECTIVE 2719); enzyme regulato... 38.5 0.005 ath:AT2G19560 EER5; EER5 (ENHANCED ETHYLENE RESPONSE 5) 30.8 1.0 hsa:65250 C5orf42, DKFZp686K02105, FLJ13231, FLJ21126; chromos... 28.9 3.6 > tgo:TGME49_092220 26S proteasome non-ATPase regulatory subunit, putative ; K03033 26S proteasome regulatory subunit N3 Length=558 Score = 67.4 bits (163), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y+ IVL VRSGDLHAFA V+ E F D T L+RRLH NVIRAGLR+ISL Sbjct 381 YKHIVLAVRSGDLHAFARVMSDFEKAFIKDGTLFLIRRLHHNVIRAGLRLISL 433 > pfa:MAL13P1.190 proteasome regulatory component, putative; K03033 26S proteasome regulatory subunit N3 Length=503 Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y+ +V VR+GD++ FA V+ + F D + L++R+H NVI+ LRII+L Sbjct 329 YKHVVSAVRNGDINKFAQVMNNYTDLFIHDGVYLLIKRIHHNVIKTALRIINL 381 > bbo:BBOV_II001520 18.m06117; 26S proteasome non-ATPase regulatory subunit 3; K03033 26S proteasome regulatory subunit N3 Length=512 Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y E+V+ V +GDL F+ V +++ F+ DDT L+ RL NVI+ GLR I+L Sbjct 335 YEEVVITVMNGDLIEFSKVCGKYKTLFEKDDTMFLISRLRHNVIKGGLRKINL 387 > xla:444384 psmd3, MGC82894; proteasome (prosome, macropain) 26S subunit, non-ATPase, 3; K03033 26S proteasome regulatory subunit N3 Length=498 Score = 47.8 bits (112), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 33/46 (71%), Gaps = 0/46 (0%) Query 8 VRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 VR+G+L F VL+Q +F+ D T+TL+ RL NVI+ G+R+ISL Sbjct 331 VRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISL 376 > dre:393544 psmd3, MGC65867, zgc:65867, zgc:77369; proteasome (prosome, macropain) 26S subunit, non-ATPase, 3; K03033 26S proteasome regulatory subunit N3 Length=503 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 8 VRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 VR+G+L F VL Q +F+ D T+TL+ RL NVI+ G+R+ISL Sbjct 336 VRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISL 381 > mmu:22123 Psmd3, AI255837, AntP91a, D11Bwg1349e, Psd3, Tstap91a; proteasome (prosome, macropain) 26S subunit, non-ATPase, 3; K03033 26S proteasome regulatory subunit N3 Length=530 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 8 VRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 VR+G+L F VL Q +F+ D T+TL+ RL NVI+ G+R+ISL Sbjct 363 VRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISL 408 > hsa:5709 PSMD3, P58, RPN3, S3, TSTA2; proteasome (prosome, macropain) 26S subunit, non-ATPase, 3; K03033 26S proteasome regulatory subunit N3 Length=534 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 8 VRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 VR+G+L F VL Q +F+ D T+TL+ RL NVI+ G+R+ISL Sbjct 367 VRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISL 412 > tpv:TP04_0438 proteasome regulatory component; K03033 26S proteasome regulatory subunit N3 Length=510 Score = 46.2 bits (108), Expect = 2e-05, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y IV+ VR+GDL F + ++ F DDT L+ RL NVI+ GLR I+L Sbjct 338 YESIVVAVRNGDLSVFLQLCDKYARCFVKDDTMFLISRLRDNVIKGGLRKINL 390 > cpv:cgd8_4060 26S proteasomal subunit S3; PINT domain containing protein ; K03033 26S proteasome regulatory subunit N3 Length=551 Score = 45.8 bits (107), Expect = 3e-05, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 0/51 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRII 51 Y E+V VRSGD+ F LQ+ ++ D T +L++RL NVIR+GL+ I Sbjct 379 YLELVKAVRSGDMKEFDLNLQKRGKIYERDGTLSLIKRLAHNVIRSGLKTI 429 > cel:C30C11.2 rpn-3; proteasome Regulatory Particle, Non-ATPase-like family member (rpn-3); K03033 26S proteasome regulatory subunit N3 Length=504 Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y ++ VR GD+ F L+Q + +F+ DDT TL+ RL QNVI+ ++ ISL Sbjct 328 YLDLSRGVRDGDVARFNHNLEQFKTQFEADDTLTLIVRLRQNVIKTAIKQISL 380 > sce:YER021W RPN3, SUN2; Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control; K03033 26S proteasome regulatory subunit N3 Length=523 Score = 42.4 bits (98), Expect = 3e-04, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y + V+ GDL F + + +++ DDT+ L RL NVI+ G+RIISL Sbjct 345 YYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISL 397 > ath:AT1G75990 26S proteasome regulatory subunit S3, putative (RPN3); K03033 26S proteasome regulatory subunit N3 Length=487 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y E+ VR GDL F + ++ F D T L+ RL NVIR GLR IS+ Sbjct 312 YFELTNAVRIGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISI 364 > ath:AT1G20200 EMB2719 (EMBRYO DEFECTIVE 2719); enzyme regulator; K03033 26S proteasome regulatory subunit N3 Length=488 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y E+ VR GDL F V ++ F D T L+ RL NVIR GLR IS+ Sbjct 313 YFELTNAVRIGDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISI 365 > ath:AT2G19560 EER5; EER5 (ENHANCED ETHYLENE RESPONSE 5) Length=413 Score = 30.8 bits (68), Expect = 1.0, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRII 51 Y +IV +R GDL LQ+HE RF + +L +L V + ++ I Sbjct 285 YTKIVQALRKGDLRLLRHALQEHEDRFLRSGVYLVLEKLELQVYQRLMKKI 335 > hsa:65250 C5orf42, DKFZp686K02105, FLJ13231, FLJ21126; chromosome 5 open reading frame 42 Length=3197 Score = 28.9 bits (63), Expect = 3.6, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Query 13 LHAFAAVLQQHELRFKLDDTFTLLRRLH-----QNVIRAG 47 L +F+ L++HEL L D T L+R QNV RAG Sbjct 1577 LTSFSGKLREHELNSLLFDVHTTLKRHQSKTKSQNVFRAG 1616 Lambda K H 0.333 0.146 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2018379896 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40