bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1663_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value cel:Y54G2A.17 hypothetical protein; K00763 nicotinate phosphor... 97.4 9e-21 ath:AT2G23420 NAPRT2; NAPRT2 (NICOTINATE PHOSPHORIBOSYLTRANSFE... 94.4 8e-20 ath:AT4G36940 NAPRT1; NAPRT1 (NICOTINATE PHOSPHORIBOSYLTRANSFE... 90.1 2e-18 tgo:TGME49_008530 nicotinate phosphoribosyltransferase, putati... 73.9 1e-13 hsa:93100 NAPRT1, PP3856; nicotinate phosphoribosyltransferase... 47.8 9e-06 mmu:223646 Naprt1, 9130210N20Rik; nicotinate phosphoribosyltra... 44.7 7e-05 tgo:TGME49_009500 hypothetical protein 32.3 0.37 pfa:PF10_0017 Plasmodium exported protein (PHISTa) 30.4 1.3 cel:R13F6.10 cra-1; Central Region Assembly in meiosis abnorma... 30.0 2.1 cel:F58D5.6 hypothetical protein 30.0 2.1 ath:AT5G02310 PRT6; PRT6 (PROTEOLYSIS 6); ubiquitin-protein li... 29.3 3.5 dre:565615 Ras and Rab interactor 2-like 28.1 6.7 > cel:Y54G2A.17 hypothetical protein; K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=563 Score = 97.4 bits (241), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%) Query 1 LCRHPFQ-ESKRCFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSL-NKVRFDML 58 LCRHPF+ ESKR V K+ KL NV+W+ G + LP+L EI+ HV S+ + +R D Sbjct 470 LCRHPFEVESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHR 529 Query 59 RLYNATPYKVSVTDDLYRNTHTLWLENVPIGELQ 92 R N TPYKVSV++ LY+ HTLWL+N PIG+L+ Sbjct 530 RYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQLE 563 > ath:AT2G23420 NAPRT2; NAPRT2 (NICOTINATE PHOSPHORIBOSYLTRANSFERASE 2); nicotinate phosphoribosyltransferase (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=557 Score = 94.4 bits (233), Expect = 8e-20, Method: Composition-based stats. Identities = 47/95 (49%), Positives = 59/95 (62%), Gaps = 4/95 (4%) Query 1 LCRHPFQESKRCFVKPKKVEKLLNVWWEKGTITKD---LPSLAEIRAHVQTSLNKVRFDM 57 LCRHPF ESKR +V P++VE+LL +W +G+ + LP L EIR L +R D Sbjct 464 LCRHPFNESKRAYVVPQRVEELLKCYW-RGSADEAREVLPPLKEIRDRCIKQLENMRPDH 522 Query 58 LRLYNATPYKVSVTDDLYRNTHTLWLENVPIGELQ 92 +R N TPYKVSV+ LY H LWL P+GELQ Sbjct 523 MRRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGELQ 557 > ath:AT4G36940 NAPRT1; NAPRT1 (NICOTINATE PHOSPHORIBOSYLTRANSFERASE 1); nicotinate phosphoribosyltransferase (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=559 Score = 90.1 bits (222), Expect = 2e-18, Method: Composition-based stats. Identities = 43/94 (45%), Positives = 55/94 (58%), Gaps = 2/94 (2%) Query 1 LCRHPFQESKRCFVKPKKVEKLLNVWWEKGT--ITKDLPSLAEIRAHVQTSLNKVRFDML 58 LCRHPF ESKR +V P++VE+LL +W ++L L E+R L +R D + Sbjct 466 LCRHPFNESKRAYVVPQRVEELLKCYWRGNADEAREELEPLKELRNRCIKQLENMRPDHM 525 Query 59 RLYNATPYKVSVTDDLYRNTHTLWLENVPIGELQ 92 R N TPYKVSV+ LY H LWL P+GEL Sbjct 526 RRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGELH 559 > tgo:TGME49_008530 nicotinate phosphoribosyltransferase, putative (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=589 Score = 73.9 bits (180), Expect = 1e-13, Method: Composition-based stats. Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 0/88 (0%) Query 1 LCRHPFQESKRCFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSLNKVRFDMLRL 60 CRH + + KRCF+ P KV++LL + G + + SL E R T L +R D+ RL Sbjct 498 FCRHLYDDRKRCFLVPSKVQRLLQPYISHGKLVVEPLSLEEARMQCITGLRSLRKDLTRL 557 Query 61 YNATPYKVSVTDDLYRNTHTLWLENVPI 88 N TP+KVS +++ + H +W + P+ Sbjct 558 VNPTPFKVSASEEYFTCFHRMWQDTAPV 585 > hsa:93100 NAPRT1, PP3856; nicotinate phosphoribosyltransferase domain containing 1 (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=538 Score = 47.8 bits (112), Expect = 9e-06, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 0/63 (0%) Query 12 CFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSLNKVRFDMLRLYNATPYKVSVT 71 C V+P +VE LL + ++G + + LPSLAE RA Q SL+++ + RL + Y+V ++ Sbjct 463 CTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLS 522 Query 72 DDL 74 + L Sbjct 523 ERL 525 > mmu:223646 Naprt1, 9130210N20Rik; nicotinate phosphoribosyltransferase domain containing 1 (EC:2.4.2.11); K00763 nicotinate phosphoribosyltransferase [EC:2.4.2.11] Length=538 Score = 44.7 bits (104), Expect = 7e-05, Method: Composition-based stats. Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 0/70 (0%) Query 5 PFQESKRCFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSLNKVRFDMLRLYNAT 64 P + C VKP +VE LL ++ ++G + + LPSL E R Q SL+ +R +L + Sbjct 456 PRGTQEPCTVKPAQVEPLLRLYLQQGQLCEPLPSLDESRRFAQQSLSLLRPAHKQLQSPA 515 Query 65 PYKVSVTDDL 74 Y V++++ L Sbjct 516 VYPVALSEKL 525 > tgo:TGME49_009500 hypothetical protein Length=2981 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Query 27 WEKGTITKDLPSLAEIRAHVQTSLNKVRFDMLRLYNATPYKVSVTDDLY 75 W G +TK LP+ EI VQ S + +L+ P K T D+Y Sbjct 1011 WRDGEVTKVLPASGEIYVRVQAS-----YQDYKLWRLRPPKAHATRDIY 1054 > pfa:PF10_0017 Plasmodium exported protein (PHISTa) Length=278 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 16/72 (22%) Query 14 VKPKKVEKLLNVWWEKGTITKDLPS-LAEIRAHVQTSLNKVRFDMLRLYNATPYKVSVTD 72 + PK+V L+N+W++ I KD+ L E++ +V LNK PY D Sbjct 150 IPPKRV--LINLWYQSLNIAKDMKELLKELKGYVDEYLNK----------NNPYDC---D 194 Query 73 DLYRNTHTLWLE 84 + + +++W++ Sbjct 195 NFINDNNSIWID 206 > cel:R13F6.10 cra-1; Central Region Assembly in meiosis abnormal family member (cra-1) Length=958 Score = 30.0 bits (66), Expect = 2.1, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query 36 LPSLAEIRAHVQTSLNKVRFDMLRLYNATPYKVSVTDDLYRNTHTLWLENVPIGE 90 +P + H++ S K D++ Y ++ + V DD+ + T TLW + PIGE Sbjct 580 IPRMTAASKHMKLSAQKTACDVMNRYLSSLF---VLDDVDQITVTLWGDEDPIGE 631 > cel:F58D5.6 hypothetical protein Length=787 Score = 30.0 bits (66), Expect = 2.1, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query 40 AEIRAHVQTSLNKVRFDMLRLYNATPYKVSVTDDLYRNTHTLWLE 84 A+++AH+ T +N RFD+LR Y+A+ + S T L N+ LE Sbjct 165 AQLKAHLVTIVNFNRFDLLRNYSASIIQTS-TVALTLNSQKTMLE 208 > ath:AT5G02310 PRT6; PRT6 (PROTEOLYSIS 6); ubiquitin-protein ligase Length=2006 Score = 29.3 bits (64), Expect = 3.5, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Query 47 QTSLNKVRFDMLRLYNATPYKVSVTDDLYRNTHTLWLEN 85 Q+ LN V+ ++ +++N P + + D+L R++ +WL++ Sbjct 1803 QSELNHVQ-ELEKMFNIPPIDIILNDELLRSSTQIWLQH 1840 > dre:565615 Ras and Rab interactor 2-like Length=898 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 11/47 (23%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 6 FQESKRCFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSLNK 52 FQE + + L+ W ++ T+ ++LPS+ + + +++ +L K Sbjct 763 FQEEQAARILSSATSDTLHQWHQRRTLQRNLPSVDDFQNYMRVALQK 809 Lambda K H 0.321 0.135 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2003222032 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40