bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1662_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_118650 transhydrogenase, putative (EC:1.6.1.2); K00... 68.2 6e-12 cpv:cgd8_2330 pyridine nucleotide/ NAD(P) transhydrogenase alp... 59.3 3e-09 pfa:PF14_0508 pyridine nucleotide transhydrogenase, putative (... 56.2 2e-08 eco:b1603 pntA, ECK1598, JW1595; pyridine nucleotide transhydr... 51.6 7e-07 cel:C15H9.1 nnt-1; Nicotinamide Nucleotide Transhydrogenase fa... 47.4 1e-05 tgo:TGME49_101210 NAD(P) transhydrogenase, alpha subunit, puta... 42.7 2e-04 dre:406619 nnt, wu:fa20d10, wu:fc86a04, zgc:76979; nicotinamid... 40.4 0.001 xla:447528 nnt, MGC83563; nicotinamide nucleotide transhydroge... 39.3 0.003 cpv:cgd1_990 pyridine nucleotide/ NAD(P) transhydrogenase alph... 35.0 0.058 dre:100331743 Nicotinamide Nucleotide Transhydrogenase family ... 34.7 0.077 tgo:TGME49_115260 alanine dehydrogenase, putative (EC:1.4.1.1) 34.3 0.095 mmu:71664 Mettl7b, 0610006F02Rik, AI266817; methyltransferase ... 28.1 6.3 mmu:70152 Mettl7a1, 2210414H16Rik, 3300001H21Rik, Aam-B, Mettl... 28.1 6.4 mmu:393082 Mettl7a2, Gm921, UbiE2, Ubie; methyltransferase lik... 28.1 6.4 hsa:196410 METTL7B, MGC17301; methyltransferase like 7B 28.1 7.9 > tgo:TGME49_118650 transhydrogenase, putative (EC:1.6.1.2); K00322 NAD(P) transhydrogenase [EC:1.6.1.1] Length=1013 Score = 68.2 bits (165), Expect = 6e-12, Method: Composition-based stats. Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%) Query 14 AQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 AQ+++++ + + DV+ICTAAIHGKPSPKLIS DML TM+PGS Sbjct 734 AQKQMLSRVVPNVDVIICTAAIHGKPSPKLISNDMLATMRPGS 776 > cpv:cgd8_2330 pyridine nucleotide/ NAD(P) transhydrogenase alpha plus beta subunits, duplicated gene, possible signal peptide plus 12 transmembrane regions ; K00322 NAD(P) transhydrogenase [EC:1.6.1.1] Length=1143 Score = 59.3 bits (142), Expect = 3e-09, Method: Composition-based stats. Identities = 26/45 (57%), Positives = 35/45 (77%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 + AQ +L + I+ CDVVI TA I GKPSPK+I+R+M+ +MKPGS Sbjct 822 LKAQSKLYSKMIRSCDVVITTALIPGKPSPKIITREMVNSMKPGS 866 > pfa:PF14_0508 pyridine nucleotide transhydrogenase, putative (EC:1.6.1.2); K00322 NAD(P) transhydrogenase [EC:1.6.1.1] Length=1176 Score = 56.2 bits (134), Expect = 2e-08, Method: Composition-based stats. Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 I Q L IK CD++IC+A+I GK SPKL++ +M++ MKPGS Sbjct 879 IKVQSNLFKKIIKKCDILICSASIPGKTSPKLVTTEMIKLMKPGS 923 > eco:b1603 pntA, ECK1598, JW1595; pyridine nucleotide transhydrogenase, alpha subunit (EC:1.6.1.2); K00324 NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2] Length=510 Score = 51.6 bits (122), Expect = 7e-07, Method: Composition-based stats. Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 I A+ EL A K D+++ TA I GKP+PKLI+R+M+ +MK GS Sbjct 235 IKAEMELFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGS 279 > cel:C15H9.1 nnt-1; Nicotinamide Nucleotide Transhydrogenase family member (nnt-1); K00323 NAD(P) transhydrogenase [EC:1.6.1.2] Length=1041 Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats. Identities = 21/45 (46%), Positives = 32/45 (71%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 I A+ +L A+ K D++I TA I GK +P LI+ +M+++MKPGS Sbjct 263 IDAEMKLFADQCKDVDIIITTALIPGKKAPILITEEMIKSMKPGS 307 > tgo:TGME49_101210 NAD(P) transhydrogenase, alpha subunit, putative (EC:1.6.1.2) Length=1165 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 0/42 (0%) Query 15 QRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 + EL A + D++I TA++ G+P+PKLI ++ + TMK GS Sbjct 839 EMELFAEQCREIDILITTASLPGRPAPKLIKKEHVDTMKAGS 880 > dre:406619 nnt, wu:fa20d10, wu:fc86a04, zgc:76979; nicotinamide nucleotide transhydrogenase (EC:1.6.1.2); K00323 NAD(P) transhydrogenase [EC:1.6.1.2] Length=1079 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 I A+ +L A D++I TA I G+ +P LI+++M+ TMK GS Sbjct 293 IEAEMKLFAKQCLDVDIIITTALIPGRKAPVLITKEMVETMKDGS 337 > xla:447528 nnt, MGC83563; nicotinamide nucleotide transhydrogenase (EC:1.6.1.2); K00323 NAD(P) transhydrogenase [EC:1.6.1.2] Length=1086 Score = 39.3 bits (90), Expect = 0.003, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 I A+ +L A + D+++ TA I GK +P L +DM+ MK GS Sbjct 297 IEAEMKLFAKQCQDVDIIVTTALIPGKTAPILFRKDMIELMKEGS 341 > cpv:cgd1_990 pyridine nucleotide/ NAD(P) transhydrogenase alpha plus beta subunits, duplicated gene, 12 transmembrane domain (EC:1.6.1.2) Length=1147 Score = 35.0 bits (79), Expect = 0.058, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 + QR+LI + D+VI +A G+ P LI+++ +R MK GS Sbjct 827 LKKQRDLIEKYLCISDIVITSACKPGEECPILITKEAVRKMKSGS 871 > dre:100331743 Nicotinamide Nucleotide Transhydrogenase family member (nnt-1)-like Length=518 Score = 34.7 bits (78), Expect = 0.077, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 18 LIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 L A + D++I TA GK +P LI R+M+ +M+ GS Sbjct 3 LFAKQCRDVDIIISTALNPGKRAPVLIKREMVESMRDGS 41 > tgo:TGME49_115260 alanine dehydrogenase, putative (EC:1.4.1.1) Length=390 Score = 34.3 bits (77), Expect = 0.095, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 26 CDVVICTAAIHGKPSPKLISRDMLRTMKPGS 56 CD+++ + G+ +PK++ R+ L+ MKPGS Sbjct 231 CDLLVGAVLLPGRKAPKIVRREHLKRMKPGS 261 > mmu:71664 Mettl7b, 0610006F02Rik, AI266817; methyltransferase like 7B Length=244 Score = 28.1 bits (61), Expect = 6.3, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 27 DVVICTAAIHGKPSPKLISRDMLRTMKPG 55 DVV+CT + SP+ + +++ R ++PG Sbjct 139 DVVVCTLVLCSVQSPRKVLQEVQRVLRPG 167 > mmu:70152 Mettl7a1, 2210414H16Rik, 3300001H21Rik, Aam-B, Mettl7a, UbiE1; methyltransferase like 7A1 Length=244 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPG 55 +AA ++ T DVV+CT + + + I R++ R +KPG Sbjct 124 VAAGEDMHQVTDGSVDVVVCTLVLCSVKNQEKILREVCRVLKPG 167 > mmu:393082 Mettl7a2, Gm921, UbiE2, Ubie; methyltransferase like 7A2 Length=244 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 12 IAAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPG 55 +AA ++ T DVV+CT + + + I R++ R +KPG Sbjct 124 VAAGEDMHQVTDGSVDVVVCTLVLCSVKNQEKILREVCRVLKPG 167 > hsa:196410 METTL7B, MGC17301; methyltransferase like 7B Length=244 Score = 28.1 bits (61), Expect = 7.9, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 27 DVVICTAAIHGKPSPKLISRDMLRTMKPG 55 DVV+CT + SP+ + +++ R ++PG Sbjct 139 DVVVCTLVLCSVQSPRKVLQEVRRVLRPG 167 Lambda K H 0.324 0.132 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2005549208 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40