bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1292_orf1 Length=90 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_073090 cell division protein 48, putative (EC:3.4.2... 126 1e-29 cpv:cgd1_330 CDC48 like AAA ATPase ortholog ; K13525 transitio... 110 1e-24 pfa:PFF0940c cell division cycle protein 48 homologue, putativ... 97.1 1e-20 bbo:BBOV_IV008360 23.m05756; cell division control protein 48;... 94.0 1e-19 tpv:TP01_0937 cell division cycle protein 48; K13525 transitio... 84.3 9e-17 cel:C06A1.1 cdc-48.1; Cell Division Cycle related family membe... 50.8 1e-06 dre:563679 MGC136908; zgc:136908 49.7 2e-06 cel:C41C4.8 cdc-48.2; Cell Division Cycle related family membe... 48.5 5e-06 xla:380491 vcp, MGC52611; valosin containing protein; K13525 t... 48.1 6e-06 ath:AT3G09840 CDC48; CDC48 (CELL DIVISION CYCLE 48); ATPase/ i... 45.8 3e-05 tpv:TP03_0490 cell division cycle protein 48; K13525 transitio... 44.3 1e-04 ath:AT5G03340 cell division cycle protein 48, putative / CDC48... 42.7 3e-04 bbo:BBOV_IV001700 21.m02769; cell division cycle protein ATPas... 41.6 6e-04 tgo:TGME49_121640 cell division protein 48, putative ; K13525 ... 41.6 6e-04 dre:327197 vcp, CDC48, wu:fd16d05, wu:fj63d11; valosin contain... 40.0 0.002 mmu:269523 Vcp, 3110001E05, CDC48, p97, p97/VCP; valosin conta... 39.3 0.003 hsa:7415 VCP, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97... 39.3 0.003 sce:YDL126C CDC48; ATPase in ER, nuclear membrane and cytosol ... 36.6 0.022 ath:AT3G53230 cell division cycle protein 48, putative / CDC48... 32.7 0.25 dre:562585 itpr2, si:dkey-196d8.1; inositol 1,4,5-triphosphate... 31.6 0.59 ath:AT2G27600 SKD1; SKD1 (SUPPRESSOR OF K+ TRANSPORT GROWTH DE... 28.9 4.6 tgo:TGME49_002020 hypothetical protein 28.5 4.8 pfa:PF07_0047 cell division cycle ATPase, putative 28.5 5.2 > tgo:TGME49_073090 cell division protein 48, putative (EC:3.4.21.53); K13525 transitional endoplasmic reticulum ATPase Length=811 Score = 126 bits (317), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 8/94 (8%) Query 1 RAAKAAIRDAIAAEELARAAGNEGMDED------ESNVKYEITRKHFEEGIAGARRSVSQ 54 RAAKAAIRDAIAAEELA+ N G DE ++++ YEITRKHFEEG+AGARRSVSQ Sbjct 699 RAAKAAIRDAIAAEELAQV--NAGADEMDAEEEEKTDIVYEITRKHFEEGLAGARRSVSQ 756 Query 55 TDLSKYDSFRMKFDPIYKSQAAGGDGTIIVDWPN 88 TDL+KYD+FRMKFDP+YKSQAAGG+ ++++WP+ Sbjct 757 TDLTKYDNFRMKFDPLYKSQAAGGETQVLIEWPD 790 > cpv:cgd1_330 CDC48 like AAA ATPase ortholog ; K13525 transitional endoplasmic reticulum ATPase Length=820 Score = 110 bits (274), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 59/93 (63%), Positives = 74/93 (79%), Gaps = 7/93 (7%) Query 1 RAAKAAIRDAIAAEELARAAGNEGM----DEDESNVKYEITRKHFEEGIAGARRSVSQTD 56 RAAKAAIRDAIAAEEL +A+G++ DE +S++ YEI RKHFEE AGARRSVS TD Sbjct 713 RAAKAAIRDAIAAEELKKASGDDSAMKIEDEVDSHI-YEIGRKHFEEAFAGARRSVSITD 771 Query 57 LSKYDSFRMKFDPIYKSQAAGGDGTIIVDWPNT 89 L+KYD FRMKFDP+Y +Q +GG+G +DWP++ Sbjct 772 LAKYDQFRMKFDPVYVTQ-SGGEG-FTIDWPDS 802 > pfa:PFF0940c cell division cycle protein 48 homologue, putative; K13525 transitional endoplasmic reticulum ATPase Length=828 Score = 97.1 bits (240), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 41/69 (59%), Positives = 53/69 (76%), Gaps = 0/69 (0%) Query 22 NEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKYDSFRMKFDPIYKSQAAGGDGT 81 N+ D+ N+KYEITR HF+EG+AGARRSVSQ DL KYD+FR+KFDP+YK++ G Sbjct 744 NDQQKNDDDNIKYEITRHHFKEGLAGARRSVSQADLIKYDNFRIKFDPLYKTKTGGTGDD 803 Query 82 IIVDWPNTD 90 I+DWP+ D Sbjct 804 FIIDWPDED 812 > bbo:BBOV_IV008360 23.m05756; cell division control protein 48; K13525 transitional endoplasmic reticulum ATPase Length=804 Score = 94.0 bits (232), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 5/87 (5%) Query 2 AAKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKYD 61 AA++AIRDAIA EE EG + YEI RKHF+EG+A AR SV+ TDL+K+D Sbjct 704 AARSAIRDAIAYEEKHGKTPTEGT----PDFTYEIQRKHFQEGLANARHSVTSTDLAKFD 759 Query 62 SFRMKFDPIYKSQAAGGDGTIIVDWPN 88 +FR KFDP+YK++ AGGD I +DWP+ Sbjct 760 NFRNKFDPLYKTRGAGGD-EIDIDWPD 785 > tpv:TP01_0937 cell division cycle protein 48; K13525 transitional endoplasmic reticulum ATPase Length=811 Score = 84.3 bits (207), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 0/58 (0%) Query 33 KYEITRKHFEEGIAGARRSVSQTDLSKYDSFRMKFDPIYKSQAAGGDGTIIVDWPNTD 90 KYEITRKHF+EG+A AR SV+ +D++KYD+FR KFDP+YK++ + G I +DWP D Sbjct 740 KYEITRKHFQEGLANARHSVTSSDITKYDAFRTKFDPLYKNRNSTGQNDIDIDWPEND 797 > cel:C06A1.1 cdc-48.1; Cell Division Cycle related family member (cdc-48.1); K13525 transitional endoplasmic reticulum ATPase Length=809 Score = 50.8 bits (120), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 7/70 (10%) Query 1 RAAKAAIRDAIAAE-------ELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVS 53 RA K AIR++I E + +A G E M++D + EITR HFEE + ARRSV+ Sbjct 700 RACKLAIRESIEKEIRIEKERQDRQARGEELMEDDAVDPVPEITRAHFEEAMKFARRSVT 759 Query 54 QTDLSKYDSF 63 D+ KY+ F Sbjct 760 DNDIRKYEMF 769 > dre:563679 MGC136908; zgc:136908 Length=805 Score = 49.7 bits (117), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Query 1 RAAKAAIRDAIAAE---ELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDL 57 RA K AIR+AI AE E R A E +D+ + EI + HFEE + ARRSVS D+ Sbjct 695 RACKLAIREAIEAEIRAERQRQARKETAMDDDYDPVPEIRKDHFEEAMRFARRSVSDNDI 754 Query 58 SKYDSF 63 KY+ F Sbjct 755 RKYEMF 760 > cel:C41C4.8 cdc-48.2; Cell Division Cycle related family member (cdc-48.2); K13525 transitional endoplasmic reticulum ATPase Length=810 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 7/70 (10%) Query 1 RAAKAAIRDAIAAE---ELAR----AAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVS 53 RA K AIR++I E E R A G E M+++ ++ EITR HFEE + ARRSV+ Sbjct 698 RACKLAIRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVT 757 Query 54 QTDLSKYDSF 63 D+ KY+ F Sbjct 758 DNDIRKYEMF 767 > xla:380491 vcp, MGC52611; valosin containing protein; K13525 transitional endoplasmic reticulum ATPase Length=805 Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 3/66 (4%) Query 1 RAAKAAIRDAIAAE---ELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDL 57 RA K AIR++I E E R M+ +E + EI R HFEE + ARRSVS D+ Sbjct 693 RACKLAIRESIENEIRRERDRQTNPSAMEVEEDDPVPEIRRDHFEEAMRLARRSVSDNDI 752 Query 58 SKYDSF 63 KY+ F Sbjct 753 RKYEMF 758 > ath:AT3G09840 CDC48; CDC48 (CELL DIVISION CYCLE 48); ATPase/ identical protein binding; K13525 transitional endoplasmic reticulum ATPase Length=809 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 3/66 (4%) Query 1 RAAKAAIRDAIAAE---ELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDL 57 RA K AIR+ I + E R+ E M+ED + EI HFEE + ARRSVS D+ Sbjct 697 RACKYAIRENIEKDIEKEKRRSENPEAMEEDGVDEVSEIKAAHFEESMKYARRSVSDADI 756 Query 58 SKYDSF 63 KY +F Sbjct 757 RKYQAF 762 > tpv:TP03_0490 cell division cycle protein 48; K13525 transitional endoplasmic reticulum ATPase Length=954 Score = 44.3 bits (103), Expect = 1e-04, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Query 1 RAAKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKY 60 RAA+ AIR++I EE+ R +++ E + IT KHF+ + +R+SV Q+D+ Y Sbjct 890 RAAREAIRESIE-EEIKR---KRPLEKGEKDPVPFITNKHFQVALRNSRKSVEQSDIQLY 945 Query 61 DSFRMK 66 +SF+ K Sbjct 946 ESFKNK 951 > ath:AT5G03340 cell division cycle protein 48, putative / CDC48, putative; K13525 transitional endoplasmic reticulum ATPase Length=810 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Query 1 RAAKAAIRDAIAAE---ELARAAGNEGMDEDESNVKY-EITRKHFEEGIAGARRSVSQTD 56 RA K AIR+ I + E R+ E M+ED + + EI HFEE + ARRSVS D Sbjct 696 RACKYAIRENIEKDIENERRRSQNPEAMEEDMVDDEVSEIRAAHFEESMKYARRSVSDAD 755 Query 57 LSKYDSF 63 + KY +F Sbjct 756 IRKYQAF 762 > bbo:BBOV_IV001700 21.m02769; cell division cycle protein ATPase; K13525 transitional endoplasmic reticulum ATPase Length=922 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 4/67 (5%) Query 1 RAAKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKY 60 RAA+ AIR++I E+ R G + +E V Y IT +HF +A AR+SV + D+ +Y Sbjct 855 RAAREAIRESIE-HEIKR--GRRLKEGEEDPVPY-ITNEHFRVAMANARKSVRKEDIKRY 910 Query 61 DSFRMKF 67 + F+ K Sbjct 911 EQFKKKL 917 > tgo:TGME49_121640 cell division protein 48, putative ; K13525 transitional endoplasmic reticulum ATPase Length=963 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Query 1 RAAKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKY 60 RAAK A+R++I AE A + E E + I++KHF+E GARRSV + + Y Sbjct 863 RAAKNAVRESIQAE----VARGRPLAEGEKDPVPFISKKHFDEAFKGARRSVPEDMVKVY 918 Query 61 DSF 63 F Sbjct 919 TQF 921 > dre:327197 vcp, CDC48, wu:fd16d05, wu:fj63d11; valosin containing protein; K13525 transitional endoplasmic reticulum ATPase Length=806 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Query 1 RAAKAAIRDAIAAEELARA---AGNEGMDEDESNVKYEITRKHFEEGIAGARRSVSQTDL 57 RA K AIR++I E M+ +E + EI + HFEE + ARRSVS D+ Sbjct 693 RACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDI 752 Query 58 SKYDSF 63 KY+ F Sbjct 753 RKYEMF 758 > mmu:269523 Vcp, 3110001E05, CDC48, p97, p97/VCP; valosin containing protein; K13525 transitional endoplasmic reticulum ATPase Length=806 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 0/39 (0%) Query 25 MDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKYDSF 63 M+ +E + EI R HFEE + ARRSVS D+ KY+ F Sbjct 720 MEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMF 758 > hsa:7415 VCP, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97; valosin containing protein; K13525 transitional endoplasmic reticulum ATPase Length=806 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 0/39 (0%) Query 25 MDEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKYDSF 63 M+ +E + EI R HFEE + ARRSVS D+ KY+ F Sbjct 720 MEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMF 758 > sce:YDL126C CDC48; ATPase in ER, nuclear membrane and cytosol with homology to mammalian p97; in a complex with Npl4p and Ufd1p participates in retrotranslocation of ubiquitinated proteins from the ER into the cytosol for degradation by the proteasome; K13525 transitional endoplasmic reticulum ATPase Length=835 Score = 36.6 bits (83), Expect = 0.022, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 15/82 (18%) Query 1 RAAKAAIRDAIAAE---ELARAAGNEGMD------------EDESNVKYEITRKHFEEGI 45 RAAK AI+D+I A E + EG D E E + IT++HF E + Sbjct 703 RAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAM 762 Query 46 AGARRSVSQTDLSKYDSFRMKF 67 A+RSVS +L +Y+++ + Sbjct 763 KTAKRSVSDAELRRYEAYSQQM 784 > ath:AT3G53230 cell division cycle protein 48, putative / CDC48, putative; K13525 transitional endoplasmic reticulum ATPase Length=815 Score = 32.7 bits (73), Expect = 0.25, Method: Compositional matrix adjust. Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 0/24 (0%) Query 40 HFEEGIAGARRSVSQTDLSKYDSF 63 HFEE + ARRSVS D+ KY +F Sbjct 738 HFEESMKYARRSVSDADIRKYQAF 761 > dre:562585 itpr2, si:dkey-196d8.1; inositol 1,4,5-triphosphate receptor, type 2; K04959 inositol 1,4,5-triphosphate receptor type 2 Length=2588 Score = 31.6 bits (70), Expect = 0.59, Method: Composition-based stats. Identities = 17/81 (20%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Query 3 AKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRK--HFEEGIAGARRSVSQTDLSKY 60 A+ IR +++ + + + S ++++ R H E + G + S Y Sbjct 1801 AQKEIRSSVSVNMFELSCRKREEESEGSGIRHKKVRDSLHLREEMRGQLKDASSVTSKAY 1860 Query 61 DSFRMKFDPIYKSQAAGGDGT 81 +FR ++DP ++ GD T Sbjct 1861 STFRREWDPDIEAVGTTGDAT 1881 > ath:AT2G27600 SKD1; SKD1 (SUPPRESSOR OF K+ TRANSPORT GROWTH DEFECT1); ATP binding / nucleoside-triphosphatase/ nucleotide binding; K12196 vacuolar protein-sorting-associated protein 4 Length=435 Score = 28.9 bits (63), Expect = 4.6, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 0/39 (0%) Query 29 ESNVKYEITRKHFEEGIAGARRSVSQTDLSKYDSFRMKF 67 E + ITR FE+ +A R +VS++DL ++ F +F Sbjct 393 EKIIPPPITRTDFEKVLARQRPTVSKSDLDVHERFTQEF 431 > tgo:TGME49_002020 hypothetical protein Length=763 Score = 28.5 bits (62), Expect = 4.8, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 0/46 (0%) Query 1 RAAKAAIRDAIAAEELARAAGNEGMDEDESNVKYEITRKHFEEGIA 46 R +KA ++ A ++ +AA + S+V+Y+ITRKHF++ A Sbjct 332 RMSKACMKAIRALCDVNQAAIDLKFILKNSDVRYDITRKHFDKLCA 377 > pfa:PF07_0047 cell division cycle ATPase, putative Length=1229 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 26 DEDESNVKYEITRKHFEEGIAGARRSVSQTDLSKYDSFRMKF 67 D D + +++KHF+ AR S+ D+ KY+ F+ K Sbjct 1183 DTDTYDPVPTLSKKHFDLAFKNARISIQPEDVLKYEKFKEKL 1224 Lambda K H 0.312 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2012433808 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40