bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1248_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_116180 FF domain-containing protein ; K12824 transc... 73.6 2e-13 bbo:BBOV_IV003090 21.m02874; hypothetical protein 54.3 9e-08 pfa:PF11_0118 conserved Plasmodium protein 36.6 0.022 ath:AT4G36360 BGAL3; BGAL3 (beta-galactosidase 3); beta-galact... 29.3 2.9 pfa:PF14_0167 prefoldin subunit 2, putative; K09549 prefoldin ... 28.9 3.7 cel:F23A7.7 hypothetical protein 28.9 4.3 sce:YHR179W OYE2; Old Yellow Enzyme (EC:1.6.99.1); K00354 NADP... 28.9 4.6 eco:b1983 yeeN, ECK1978, JW1964; conserved protein, UPF0082 fa... 28.5 4.7 tgo:TGME49_089700 hypothetical protein 28.5 5.0 ath:AT3G61420 hypothetical protein; K03141 transcription initi... 28.5 5.4 > tgo:TGME49_116180 FF domain-containing protein ; K12824 transcription elongation regulator 1 Length=772 Score = 73.6 bits (179), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 43/112 (38%), Positives = 59/112 (52%), Gaps = 36/112 (32%) Query 8 EKKKLKSLKADAATAFTNMLVERVKNPFLEAGEGNDLPTGLLKGDSRYTTNQLTETEKKE 67 E K+ + +K +AA AF NMLVERVKNPF Sbjct 622 ETKRARLVKTEAAAAFMNMLVERVKNPFTS------------------------------ 651 Query 68 LYKAFVREFSTSRVSLFASRLSTLPTEDLNLSFEQVLEKLQTAKKLFHGISE 119 REF+T R+ LF ++L+TLP E L+ SF++VLE+LQT K+LF G+ + Sbjct 652 ------REFTTGRLRLFQTKLNTLPCEKLSASFDEVLEELQTNKRLFDGLPQ 697 > bbo:BBOV_IV003090 21.m02874; hypothetical protein Length=332 Score = 54.3 bits (129), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Query 19 AATAFTNMLVERVKNPFLEAGEGNDLPTGLLKGDSRYTTNQLTETEKKELYKAFVREFST 78 A AF +ML ER++ PFL+ GE L LL+GD R + ++K LY FV EF Sbjct 185 AHNAFMSMLHERIRMPFLD-GEIVPLDDDLLQGDPR--AEGCSAKDRKVLYDKFVSEFLE 241 Query 79 SRVSLFASRLSTLPTEDLNLSFEQVLEKL 107 +R++LF +LS + +E ++ S ++ E L Sbjct 242 ARLALFDQKLSNIGSEQVSSSLDEKAELL 270 > pfa:PF11_0118 conserved Plasmodium protein Length=594 Score = 36.6 bits (83), Expect = 0.022, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query 44 LPTGLLKGDSRYTTNQLTETEKKELYKAFVREFSTSRVSLFASRLSTLPTEDLNLSFEQV 103 LP +L D RY L + EK LYK F+ + S+ F LS L +N + +++ Sbjct 428 LPRDIL-NDERYKNITLNDNEKFVLYKEFINNYIDSKKISFHKLLSELSINCINNTLDEI 486 Query 104 LEKLQTAKKLFHGIS 118 + + K+F I+ Sbjct 487 ILMIDKNNKMFKDIN 501 > ath:AT4G36360 BGAL3; BGAL3 (beta-galactosidase 3); beta-galactosidase/ catalytic/ cation binding / sugar binding Length=856 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 76 FSTSRVSLFASRLSTLPTEDLNLSFEQVLEKLQT 109 F+T++V + S++ LPT+ N +E LE L + Sbjct 418 FNTAKVGVQTSQMEMLPTDTKNFQWESYLEDLSS 451 > pfa:PF14_0167 prefoldin subunit 2, putative; K09549 prefoldin subunit 2 Length=147 Score = 28.9 bits (63), Expect = 3.7, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 35 FLEAGEGNDLPTGLLKGDSRYTTNQLTETEKK 66 F+++ + +LP G++ G+ TN L + EKK Sbjct 110 FIKSAKAGNLPGGIINGNPSEDTNNLNDKEKK 141 > cel:F23A7.7 hypothetical protein Length=965 Score = 28.9 bits (63), Expect = 4.3, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Query 39 GEGNDLPTGLLKGDSRYTTNQLTETEKKELYKAFVREFSTSRVSLFASRLSTLPTEDLNL 98 G+ + P+G +K RY N L + LY A E SL ++ +S+L T L Sbjct 852 GDLMNWPSGFIK--DRYDFNNLEQCLSGLLYSAIKLEDENVDTSLLSTAVSSLFTNHLKT 909 Query 99 SFEQ 102 FE Sbjct 910 RFEH 913 > sce:YHR179W OYE2; Old Yellow Enzyme (EC:1.6.99.1); K00354 NADPH2 dehydrogenase [EC:1.6.99.1] Length=400 Score = 28.9 bits (63), Expect = 4.6, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 16 KADAATAFTNMLVERVKNPFLEAGEG 41 KA AF +++ RV NPFL GEG Sbjct 278 KAGKRLAFVHLVEPRVTNPFLTEGEG 303 > eco:b1983 yeeN, ECK1978, JW1964; conserved protein, UPF0082 family Length=238 Score = 28.5 bits (62), Expect = 4.7, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 11/71 (15%) Query 58 NQLTETEKKELYK-------AFVREFSTSRVSLFASRLSTLPTEDLNLSFEQVLEKLQ-- 108 N + TE +L+K A + EFST+ + + A L EDL + FE +++ L+ Sbjct 167 NIVIYTEPTDLHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEI-FEGLVDALEDD 225 Query 109 -TAKKLFHGIS 118 +K++H ++ Sbjct 226 DDVQKVYHNVA 236 > tgo:TGME49_089700 hypothetical protein Length=588 Score = 28.5 bits (62), Expect = 5.0, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Query 45 PTGLLKGDSRYTTNQLTETEKKELYKAFVREFSTSRVSLFASRLSTL 91 P+ L GDSR T++L ++ LY+AF R S ++S STL Sbjct 13 PSVRLHGDSREDTSRLERQQEAWLYRAFTRALLH---SFWSSSNSTL 56 > ath:AT3G61420 hypothetical protein; K03141 transcription initiation factor TFIIH subunit 1 Length=579 Score = 28.5 bits (62), Expect = 5.4, Method: Compositional matrix adjust. Identities = 16/76 (21%), Positives = 35/76 (46%), Gaps = 0/76 (0%) Query 36 LEAGEGNDLPTGLLKGDSRYTTNQLTETEKKELYKAFVREFSTSRVSLFASRLSTLPTED 95 ++A EG+D + G R TN + E + +L ++ +++ + + R + +ED Sbjct 282 MDADEGDDYTHLMDHGIQRDGTNDIIEPQNDQLKRSLLQDLNRHAAVVLEGRCINVQSED 341 Query 96 LNLSFEQVLEKLQTAK 111 + E + Q +K Sbjct 342 TRIVAEALTRAKQVSK 357 Lambda K H 0.311 0.128 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2018002440 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40