bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1055_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing... 64.3 1e-10 cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domain... 32.7 0.42 sce:YMR281W GPI12; ER membrane protein involved in the second ... 31.2 1.4 > tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing protein (EC:3.4.14.11); K06978 Length=1177 Score = 64.3 bits (155), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 27/45 (60%), Positives = 35/45 (77%), Gaps = 0/45 (0%) Query 101 YKVEYLSSSGVYSRWPIAQHPFRLFVNYGNRLLQRKKQPGFSLSL 145 Y VEY S++GV+SRW IAQHPFR V+YGNRL R+ +P F ++L Sbjct 947 YDVEYFSTTGVFSRWVIAQHPFRQAVHYGNRLFARRTRPDFPINL 991 > cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domains ; K06978 Length=1103 Score = 32.7 bits (73), Expect = 0.42, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 10/35 (28%) Query 113 SRWPIAQHPFRLFVNY----------GNRLLQRKK 137 SRW IA HPFR+ V+Y G RL Q++K Sbjct 891 SRWMIAMHPFRVTVSYNEKGKQLWHAGERLHQKRK 925 > sce:YMR281W GPI12; ER membrane protein involved in the second step of glycosylphosphatidylinositol (GPI) anchor assembly, the de-N-acetylation of the N-acetylglucosaminylphosphatidylinositol intermediate; functional homolog of human PIG-Lp (EC:3.5.1.89); K03434 N-acetylglucosaminylphosphatidylinositol deacetylase [EC:3.5.1.89] Length=304 Score = 31.2 bits (69), Expect = 1.4, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 14/63 (22%) Query 3 RRRSSRFSKLL----------SALFIAFSPQRQINNTINLQQLFIHDKNAY----LLQHP 48 RR FSKLL + L+I F+P+ N +LQ +F H Y ++ HP Sbjct 5 RRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHP 64 Query 49 DTE 51 D E Sbjct 65 DDE 67 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3003468616 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40