bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1052_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding pr... 109 3e-24 pfa:PFF0505c conserved Plasmodium protein, unknown function 46.2 3e-05 ath:AT2G20190 CLASP; CLASP (CLIP-ASSOCIATED PROTEIN); binding 30.8 1.6 > tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding protein 25 Length=779 Score = 109 bits (272), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%) Query 44 LRKLDPEAIAAAAENSIYRIAPDGTDRRTYIEEDYRPSRRELERLQNAGRREAEYEREFT 103 L+ ++PE AA+ S+YR+ PDG DRR YI EDYRP RRELERL + RR++E+E+EF Sbjct 375 LKAMNPELAEAASSCSVYRVGPDGVDRRRYITEDYRPCRRELERLHHLERRDSEFEKEFR 434 Query 104 RREAAWKIQEQNLAVDREKELVGEMEISQEDKRRLIEADLR 144 RRE W +E++ ++EKE+ E EI +D++ LI DLR Sbjct 435 RRELEWITREEDFKQNKEKEVALEQEIRDDDRQHLINQDLR 475 > pfa:PFF0505c conserved Plasmodium protein, unknown function Length=960 Score = 46.2 bits (108), Expect = 3e-05, Method: Composition-based stats. Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 0/72 (0%) Query 73 YIEEDYRPSRRELERLQNAGRREAEYEREFTRREAAWKIQEQNLAVDREKELVGEMEISQ 132 YI ++Y+ + RE ERLQ +E + EREF +RE W E+ + D KE + + Sbjct 416 YISKEYKINWRERERLQKTEYKEKDLEREFYKREKEWIELEEQIKKDTYKEWNKYLLSKK 475 Query 133 EDKRRLIEADLR 144 +D +LIE DL+ Sbjct 476 KDIAKLIEIDLK 487 > ath:AT2G20190 CLASP; CLASP (CLIP-ASSOCIATED PROTEIN); binding Length=1439 Score = 30.8 bits (68), Expect = 1.6, Method: Compositional matrix adjust. Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 26/106 (24%) Query 12 GSSGSNLTNGSS-----SSKTAAAAAADTAAGSAFHRLRKLDPE----AIAAAAENSIYR 62 G G N+++G+ + +T ++A+D L+P+ A+A +NSI R Sbjct 1092 GGVGQNVSSGTQEKLYQNVRTGISSASDL-----------LNPKDSDYTFASAGQNSISR 1140 Query 63 IAPDGTDRRTYIEEDYRPSRRELERLQNA------GRREAEYEREF 102 +P+G+ I +D P E L GR E E RE Sbjct 1141 TSPNGSSENIEILDDLSPPHLEKNGLNLTSVDSLEGRHENEVSREL 1186 Lambda K H 0.306 0.121 0.320 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2814663556 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40