bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0988_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_031970 pre-mRNA splicing factor PRP8, putative ; K1... 162 3e-40 pfa:PFD0265w pre-mRNA splicing factor, putative; K12856 pre-mR... 159 3e-39 tpv:TP03_0292 splicing factor Prp8; K12856 pre-mRNA-processing... 157 9e-39 cel:C50C3.6 prp-8; yeast PRP (splicing factor) related family ... 156 1e-38 bbo:BBOV_IV007790 23.m06497; processing splicing factor 8; K12... 155 3e-38 mmu:192159 Prpf8, AU019467, D11Bwg0410e, DBF3/PRP8, Prp8, Sfpr... 155 4e-38 dre:393951 prpf8, MGC162871, MGC56504, id:ibd1257, ik:tdsubc_2... 155 4e-38 hsa:10594 PRPF8, HPRP8, PRP8, PRPC8, RP13; PRP8 pre-mRNA proce... 155 4e-38 xla:379945 prpf8, MGC52804, hprp8, prp-8, prp8, prpc8, rp13; P... 154 5e-38 ath:AT4G38780 splicing factor, putative 154 1e-37 ath:AT1G80070 SUS2; SUS2 (ABNORMAL SUSPENSOR 2); K12856 pre-mR... 153 1e-37 cpv:cgd3_2890 Prp8. JAB/PAD domain ; K12856 pre-mRNA-processin... 147 8e-36 sce:YHR165C PRP8, DBF3, DNA39, RNA8, SLT21, USA2; Component of... 132 3e-31 mmu:113851 Vmn1r54, V1ra9, VN7; vomeronasal 1 receptor 54; K04... 30.0 1.8 mmu:100043597 Srcap, B930091H02Rik, D030022P06Rik, F630004O05R... 29.3 3.0 hsa:10847 SRCAP, DOMO1, EAF1, FLJ44499, KIAA0309, SWR1; Snf2-r... 29.3 3.0 hsa:83889 WDR87, FLJ52608, NYD-SP11; WD repeat domain 87 28.1 cpv:cgd5_820 calcium/calmodulin dependent protein kinase with ... 27.7 8.5 dre:100151066 MGC195210; cardiomyopathy associated 5 like 27.7 8.6 dre:560687 cmya5, cmya5l; cardiomyopathy associated 5 27.7 > tgo:TGME49_031970 pre-mRNA splicing factor PRP8, putative ; K12856 pre-mRNA-processing factor 8 Length=2538 Score = 162 bits (410), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 77/87 (88%), Positives = 82/87 (94%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FRVFK+TKFFQ TE+DWVE GLQV+RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 675 FRVFKSTKFFQCTELDWVEVGLQVARQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 734 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 735 KERKKSRFGNAFHLCREILRLTKLVVD 761 Score = 48.1 bits (113), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 30/43 (69%), Gaps = 5/43 (11%) Query 64 KKSRFGNA-----FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 +KS+ G + E LRKLIKDHGDM+S+K+RHD+RVY Sbjct 246 EKSKLGTGQDTTKEEMPPEHLRKLIKDHGDMTSKKFRHDKRVY 288 > pfa:PFD0265w pre-mRNA splicing factor, putative; K12856 pre-mRNA-processing factor 8 Length=3136 Score = 159 bits (401), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 0/80 (0%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR+FK+TKFFQ TE+DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 1018 FRIFKSTKFFQCTEMDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 1077 Query 61 KERKKSRFGNAFHLCREILR 80 KERKKSRFGNAFHLCREILR Sbjct 1078 KERKKSRFGNAFHLCREILR 1097 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/25 (68%), Positives = 24/25 (96%), Gaps = 0/25 (0%) Query 77 EILRKLIKDHGDMSSRKYRHDRRVY 101 E LRK++K+HGDMS++KYR+D+RVY Sbjct 410 EHLRKIVKEHGDMSNKKYRYDKRVY 434 > tpv:TP03_0292 splicing factor Prp8; K12856 pre-mRNA-processing factor 8 Length=2736 Score = 157 bits (396), Expect = 9e-39, Method: Compositional matrix adjust. Identities = 75/87 (86%), Positives = 80/87 (91%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 F+VF+ TKFFQ TE+DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 887 FKVFRGTKFFQSTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 946 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 947 KERKKSRFGNAFHLCREILRLTKLVVD 973 Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%) Query 72 FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 + E +RK+I+DHGDMSSR+YR+D+RVY Sbjct 278 LQMPPEHVRKVIRDHGDMSSRRYRYDKRVY 307 > cel:C50C3.6 prp-8; yeast PRP (splicing factor) related family member (prp-8); K12856 pre-mRNA-processing factor 8 Length=2329 Score = 156 bits (395), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 76/87 (87%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR FK TKFFQ T +DWVEAGLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 465 FRSFKATKFFQTTTLDWVEAGLQVLRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 524 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 525 KERKKSRFGNAFHLCREILRLTKLVVD 551 Score = 47.0 bits (110), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 31/42 (73%), Gaps = 4/42 (9%) Query 64 KKSRFGNA----FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 +K +FG + + E +RK+I+DHGDM+SRKYRHD+RVY Sbjct 37 EKKKFGMSDTQKEEMPPEHVRKVIRDHGDMTSRKYRHDKRVY 78 > bbo:BBOV_IV007790 23.m06497; processing splicing factor 8; K12856 pre-mRNA-processing factor 8 Length=2343 Score = 155 bits (392), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 F+VF+ TKFFQ TE+DWVEAGLQV QGYNMLNLLIHRKNL YLHLDYNFNL+PVKTLTT Sbjct 496 FKVFRATKFFQTTELDWVEAGLQVCHQGYNMLNLLIHRKNLTYLHLDYNFNLKPVKTLTT 555 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 556 KERKKSRFGNAFHLCREILRLTKLVVD 582 Score = 41.2 bits (95), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 24/28 (85%), Gaps = 0/28 (0%) Query 74 LCREILRKLIKDHGDMSSRKYRHDRRVY 101 + E LRK+ ++HGDMS+RKYR+D+RVY Sbjct 56 MPPEHLRKVFREHGDMSNRKYRYDKRVY 83 > mmu:192159 Prpf8, AU019467, D11Bwg0410e, DBF3/PRP8, Prp8, Sfprp8l; pre-mRNA processing factor 8; K12856 pre-mRNA-processing factor 8 Length=2335 Score = 155 bits (391), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR FK TKFFQ T++DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 473 FRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 532 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCRE+LR KL+ D Sbjct 533 KERKKSRFGNAFHLCREVLRLTKLVVD 559 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Query 62 ERKKSRFGNA--FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 E++K F +A + E +RK+I+DHGDM++RK+RHD+RVY Sbjct 47 EKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVY 88 > dre:393951 prpf8, MGC162871, MGC56504, id:ibd1257, ik:tdsubc_2a9, im:7141966, tdsubc_2a9, wu:fb37c02, wu:fb73e06, xx:tdsubc_2a9, zgc:56504; pre-mRNA processing factor 8; K12856 pre-mRNA-processing factor 8 Length=2342 Score = 155 bits (391), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR FK TKFFQ T++DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 480 FRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 539 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCRE+LR KL+ D Sbjct 540 KERKKSRFGNAFHLCREVLRLSKLVVD 566 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Query 62 ERKKSRFGNA--FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 E++K F +A + E +RK+I+DHGDM++RK+RHD+RVY Sbjct 54 EKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVY 95 > hsa:10594 PRPF8, HPRP8, PRP8, PRPC8, RP13; PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae); K12856 pre-mRNA-processing factor 8 Length=2335 Score = 155 bits (391), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR FK TKFFQ T++DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 473 FRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 532 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCRE+LR KL+ D Sbjct 533 KERKKSRFGNAFHLCREVLRLTKLVVD 559 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Query 62 ERKKSRFGNA--FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 E++K F +A + E +RK+I+DHGDM++RK+RHD+RVY Sbjct 47 EKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVY 88 > xla:379945 prpf8, MGC52804, hprp8, prp-8, prp8, prpc8, rp13; PRP8 pre-mRNA processing factor 8 homolog; K12856 pre-mRNA-processing factor 8 Length=2335 Score = 154 bits (390), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR FK TKFFQ T++DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 473 FRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 532 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCRE+LR KL+ D Sbjct 533 KERKKSRFGNAFHLCREVLRLTKLVVD 559 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Query 62 ERKKSRFGNA--FHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 E++K F +A + E +RK+I+DHGDM++RK+RHD+RVY Sbjct 47 EKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVY 88 > ath:AT4G38780 splicing factor, putative Length=2332 Score = 154 bits (388), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 77/87 (88%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR TKFFQ TE+DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 471 FRSLAATKFFQSTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 530 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 531 KERKKSRFGNAFHLCREILRLTKLVVD 557 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Query 53 RPVKTLTTKERKKSRFGNAFHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 R T+ T E +++ ++ K +DHGDMSS+K+R D+RVY Sbjct 37 RNTPTVPTPEDAEAKLEKKARTWMQLNSK--RDHGDMSSKKHRLDKRVY 83 > ath:AT1G80070 SUS2; SUS2 (ABNORMAL SUSPENSOR 2); K12856 pre-mRNA-processing factor 8 Length=2382 Score = 153 bits (387), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 74/87 (85%), Positives = 77/87 (88%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 FR TKFFQ TE+DWVE GLQV RQGYNMLNLLIHRKNLNYLHLDYNFNL+PVKTLTT Sbjct 519 FRSLAATKFFQSTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTT 578 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCREILR KL+ D Sbjct 579 KERKKSRFGNAFHLCREILRLTKLVVD 605 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%) Query 82 LIKDHGDMSSRKYRHDRRVY 101 L +DHGDMSS+K+RHD+RVY Sbjct 116 LARDHGDMSSKKFRHDKRVY 135 > cpv:cgd3_2890 Prp8. JAB/PAD domain ; K12856 pre-mRNA-processing factor 8 Length=2379 Score = 147 bits (371), Expect = 8e-36, Method: Compositional matrix adjust. Identities = 68/87 (78%), Positives = 77/87 (88%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 ++ + TKFFQ TE+DWVE GLQV +QGYNMLNLLIHRKNL YLHLDYNFNL+P+KTLTT Sbjct 463 LKILQNTKFFQSTEMDWVEVGLQVCKQGYNMLNLLIHRKNLTYLHLDYNFNLKPIKTLTT 522 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSRFGNAFHLCRE+LR KL+ D Sbjct 523 KERKKSRFGNAFHLCREVLRLTKLVVD 549 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%) Query 74 LCREILRKLIKDHGDMSSRKYRHDRRVY 101 L E LRKLI HGDMSSRK+++++RVY Sbjct 49 LPPEHLRKLINIHGDMSSRKFQNEKRVY 76 > sce:YHR165C PRP8, DBF3, DNA39, RNA8, SLT21, USA2; Component of the U4/U6-U5 snRNP complex, involved in the second catalytic step of splicing; mutations of human Prp8 cause retinitis pigmentosa; K12856 pre-mRNA-processing factor 8 Length=2413 Score = 132 bits (332), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 64/87 (73%), Positives = 72/87 (82%), Gaps = 2/87 (2%) Query 1 FRVFKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTT 60 + K TK+FQ T IDWVEAGLQ+ RQG+NMLNLLIHRK L YLHLDYNFNL+P KTLTT Sbjct 548 LKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTT 607 Query 61 KERKKSRFGNAFHLCREILR--KLIKD 85 KERKKSR GN+FHL RE+L+ KLI D Sbjct 608 KERKKSRLGNSFHLMRELLKMMKLIVD 634 Score = 33.5 bits (75), Expect = 0.17, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 55 VKTLTTKERKKSRFGNAFHLCREILRKLIKDHGDMSSRKYRHDRRVY 101 K +T K ++ + + + E LRK+I H DM+S+ Y D++ + Sbjct 115 AKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAF 161 > mmu:113851 Vmn1r54, V1ra9, VN7; vomeronasal 1 receptor 54; K04614 vomeronasal1 receptor Length=315 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query 4 FKTTKFFQLTEIDWVEAGLQVSRQGYNMLNLLIHRKNLNYLHLDYNFNLRP 54 F T F LT D + GL + GY + L H+K +LH+ +F+L+P Sbjct 181 FHLTVFILLTSRDVIFVGLMLLSSGYMVTFLGRHKKQSQFLHIT-SFSLKP 230 > mmu:100043597 Srcap, B930091H02Rik, D030022P06Rik, F630004O05Rik; Snf2-related CREBBP activator protein; K11661 helicase SRCAP [EC:3.6.4.-] Length=3237 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query 61 KERKKSRFG----NAFHLCREILRKLIKDHGDMSSRKYRH 96 KERK R G NAFH+C + +++DH + +R+ Sbjct 715 KERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRY 754 > hsa:10847 SRCAP, DOMO1, EAF1, FLJ44499, KIAA0309, SWR1; Snf2-related CREBBP activator protein; K11661 helicase SRCAP [EC:3.6.4.-] Length=3230 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query 61 KERKKSRFG----NAFHLCREILRKLIKDHGDMSSRKYRH 96 KERK R G NAFH+C + +++DH + +R+ Sbjct 703 KERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRY 742 > hsa:83889 WDR87, FLJ52608, NYD-SP11; WD repeat domain 87 Length=2873 Score = 28.1 bits (61), Expect = 7.0, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 11/46 (23%) Query 12 LTEIDWV-------EAGLQVSRQGYN----MLNLLIHRKNLNYLHL 46 L++++W+ EAG Q+SR G++ +L L + NL +LHL Sbjct 2522 LSDVEWIRHVLERMEAGEQLSRDGFHRLCQLLKDLASKGNLEWLHL 2567 > cpv:cgd5_820 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands ; K13412 calcium-dependent protein kinase [EC:2.7.11.1] Length=523 Score = 27.7 bits (60), Expect = 8.5, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query 33 NLLIHRKNLNYLHLDYNFNLRPVKTLTTKERKKSRFGNAFHLCREILRKLIKDHGDMSS 91 NLL+ K + L +F L V +++ K R G A+++ E+LRK + D+ S Sbjct 189 NLLLESKEKDALIKIVDFGLSAV--FENQKKMKERLGTAYYIAPEVLRKKYDEKCDVWS 245 > dre:100151066 MGC195210; cardiomyopathy associated 5 like Length=1759 Score = 27.7 bits (60), Expect = 8.6, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 11/75 (14%) Query 27 QGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTTKERKKSRF----GNAFHLCREILRKL 82 +GY LL + N NYL F ++ V + E+ ++ G FH RE + Sbjct 1540 KGYEQRVLL--QPNENYL-----FYIKSVNAGGSSEQSEAALISTRGTRFHFLRESAHSV 1592 Query 83 IKDHGDMSSRKYRHD 97 +K D +S +Y HD Sbjct 1593 LKVSEDRNSVEYPHD 1607 > dre:560687 cmya5, cmya5l; cardiomyopathy associated 5 Length=1759 Score = 27.7 bits (60), Expect = 8.6, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 11/75 (14%) Query 27 QGYNMLNLLIHRKNLNYLHLDYNFNLRPVKTLTTKERKKSRF----GNAFHLCREILRKL 82 +GY LL + N NYL F ++ V + E+ ++ G FH RE + Sbjct 1540 KGYEQRVLL--QPNENYL-----FYIKSVNAGGSSEQSEAALISTRGTRFHFLRESAHSV 1592 Query 83 IKDHGDMSSRKYRHD 97 +K D +S +Y HD Sbjct 1593 LKVSEDRNSVEYPHD 1607 Lambda K H 0.328 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2036602604 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40