bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0939_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_085660 DEAD/DEAH box helicase domain-containing pro... 81.6 5e-16 bbo:BBOV_II002350 18.m06191; helicase with zinc finger motif p... 67.0 1e-11 ath:AT3G46960 ATP binding / ATP-dependent helicase/ helicase/ ... 62.0 5e-10 dre:559653 skiv2l, fb70b07, wu:fb70b07; superkiller viralicidi... 58.2 7e-09 dre:100331276 superkiller viralicidic activity 2-like; K12599 ... 56.6 2e-08 mmu:108077 Skiv2l, 4930534J06Rik, AW214248, Ddx13, SKI, Ski2w;... 56.2 2e-08 hsa:6499 SKIV2L, 170A, DDX13, HLP, SKI2, SKI2W, SKIV2; superki... 55.8 4e-08 pfa:PFI0480w helicase with Zn-finger motif, putative; K12599 a... 53.5 2e-07 tpv:TP04_0364 hypothetical protein; K12599 antiviral helicase ... 52.4 3e-07 bbo:BBOV_II005660 18.m06470; DSHCT (NUC185) domain containing ... 51.2 8e-07 pfa:PFF0100w ATP-dependent RNA Helicase, putative (EC:3.6.1.-)... 50.1 2e-06 tpv:TP02_0517 hypothetical protein; K12598 ATP-dependent RNA h... 49.7 2e-06 sce:YLR398C SKI2; Ski complex component and putative RNA helic... 48.9 4e-06 cel:W08D2.7 mtr-4; yeast MTR (mRNA TRansport) homolog family m... 48.9 4e-06 cpv:cgd3_280 mRNA translation inhibitor SKI2 SFII helicase, DE... 48.9 4e-06 dre:406795 skiv2l2, wu:fd11a05, zgc:63838; superkiller viralic... 47.8 1e-05 tgo:TGME49_013770 RNA helicase, putative ; K12598 ATP-dependen... 47.0 2e-05 ath:AT1G59760 ATP-dependent RNA helicase, putative; K12598 ATP... 45.8 3e-05 cel:F01G4.3 hypothetical protein; K12599 antiviral helicase SK... 45.8 3e-05 mmu:72198 Skiv2l2, 2610528A15Rik, mKIAA0052; superkiller viral... 43.5 1e-04 hsa:23517 SKIV2L2, Dob1, KIAA0052, MGC142069, Mtr4, fSAP118; s... 43.5 2e-04 sce:YJL050W MTR4, DOB1; ATP-dependent 3'-5' RNA helicase, invo... 42.7 3e-04 cpv:cgd8_2520 Mtr4p like SKI family SFII helicase ; K12598 ATP... 39.3 0.003 ath:AT2G06990 HEN2; HEN2 (hua enhancer 2); ATP-dependent helic... 38.9 0.004 > tgo:TGME49_085660 DEAD/DEAH box helicase domain-containing protein ; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1329 Score = 81.6 bits (200), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%) Query 79 ADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 DLSP + PLA+EF FPLDDFQKRAIL LEK Q VFVAAHTSAGKTVV Sbjct 441 GDLSPLQVPLALEFPFPLDDFQKRAILHLEKYQTVFVAAHTSAGKTVV 488 > bbo:BBOV_II002350 18.m06191; helicase with zinc finger motif protein; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1113 Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 0/45 (0%) Query 82 SPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 +PE E L IE+ F LDDFQKRAI L K + VFVAAHTS+GKTVV Sbjct 195 TPELEDLVIEYPFELDDFQKRAIYHLHKMKHVFVAAHTSSGKTVV 239 > ath:AT3G46960 ATP binding / ATP-dependent helicase/ helicase/ hydrolase, acting on acid anhydrides, in phosphorus-containing anhydrides / nucleic acid binding; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1347 Score = 62.0 bits (149), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 11/86 (12%) Query 49 AAAAAAAAAAAVTGAA--------AAAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQ 100 +A A + AVTG++ A D+ + +L P+ +AIEF F LD+FQ Sbjct 309 SAKTAIMSEEAVTGSSDKQLRKEGWATKGDSQDIADRFYELVPD---MAIEFPFELDNFQ 365 Query 101 KRAILRLEKNQCVFVAAHTSAGKTVV 126 K AI LEK + VFVAAHTSAGKTVV Sbjct 366 KEAICCLEKGESVFVAAHTSAGKTVV 391 > dre:559653 skiv2l, fb70b07, wu:fb70b07; superkiller viralicidic activity 2 (S. cerevisiae homolog)-like; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1230 Score = 58.2 bits (139), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 34/61 (55%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Query 66 AAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 A P D +SP AD A ++ F LD FQK+AILRLE + VFVAAHTSAGKTV Sbjct 292 AIPVDISSP---CADFYKRIPDPAFKYPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTV 348 Query 126 V 126 V Sbjct 349 V 349 > dre:100331276 superkiller viralicidic activity 2-like; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1235 Score = 56.6 bits (135), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Query 66 AAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 A P D SP L P+ A ++ F D FQK+AIL LE++ VFVAAHTSAGKTV Sbjct 284 AIPVDVTSPVGDFYRLIPQP---AFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTV 340 Query 126 V 126 V Sbjct 341 V 341 > mmu:108077 Skiv2l, 4930534J06Rik, AW214248, Ddx13, SKI, Ski2w; superkiller viralicidic activity 2-like (S. cerevisiae); K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1244 Score = 56.2 bits (134), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Query 66 AAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 A P D SP L P+ A ++ F D FQK+AIL LE++ VFVAAHTSAGKTV Sbjct 281 AVPVDVTSPVGDFYRLIPQP---AFQWAFEPDVFQKQAILHLEQHDSVFVAAHTSAGKTV 337 Query 126 V 126 V Sbjct 338 V 338 > hsa:6499 SKIV2L, 170A, DDX13, HLP, SKI2, SKI2W, SKIV2; superkiller viralicidic activity 2-like (S. cerevisiae); K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1246 Score = 55.8 bits (133), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Query 66 AAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 A P D SP L P+ A ++ F D FQK+AIL LE++ VFVAAHTSAGKTV Sbjct 284 AIPVDATSPVGDFYRLIPQP---AFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTV 340 Query 126 V 126 V Sbjct 341 V 341 > pfa:PFI0480w helicase with Zn-finger motif, putative; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1373 Score = 53.5 bits (127), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Query 79 ADLSP-EEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 +D+S + L + + F LDDFQKR+I L + VFVAAHTSAGKT++ Sbjct 284 SDISNFNKNDLLLNYDFELDDFQKRSIKHLNNFKHVFVAAHTSAGKTLI 332 > tpv:TP04_0364 hypothetical protein; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1069 Score = 52.4 bits (124), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/84 (35%), Positives = 38/84 (45%), Gaps = 16/84 (19%) Query 43 VAPPPDAAAAAAAAAAAVTGAAAAAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKR 102 + P PD A+ A PE L ++ F LDDFQK+ Sbjct 146 IVPKPDENKKYIRKKWAIVDDKEA----------------PELTDLIAQYPFELDDFQKK 189 Query 103 AILRLEKNQCVFVAAHTSAGKTVV 126 +I L + VFV+AHTSAGKTVV Sbjct 190 SIHHLINGKHVFVSAHTSAGKTVV 213 > bbo:BBOV_II005660 18.m06470; DSHCT (NUC185) domain containing DEAD/DEAH box helicase family protein (EC:3.6.1.3); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=986 Score = 51.2 bits (121), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 92 FGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 + F LDDFQKR+I LEK + V V AHTSAGKTVV Sbjct 80 YPFTLDDFQKRSIECLEKGESVLVCAHTSAGKTVV 114 > pfa:PFF0100w ATP-dependent RNA Helicase, putative (EC:3.6.1.-); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1350 Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Query 85 EEPL--AIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 +EPL A + F LD FQK++I LE+N+ V V+AHTSAGKTV+ Sbjct 242 KEPLIPARTYKFELDTFQKKSIECLERNESVLVSAHTSAGKTVI 285 > tpv:TP02_0517 hypothetical protein; K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1012 Score = 49.7 bits (117), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 22/36 (61%), Positives = 29/36 (80%), Gaps = 0/36 (0%) Query 91 EFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 ++ F LD+FQKR+I LE+++ V V AHTSAGKTVV Sbjct 103 KYPFTLDEFQKRSIESLERDESVLVCAHTSAGKTVV 138 > sce:YLR398C SKI2; Ski complex component and putative RNA helicase, mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay (EC:3.6.1.-); K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1287 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/33 (69%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 94 FPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 F LD FQK A+ LE+ VFVAAHTSAGKTVV Sbjct 328 FELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVV 360 > cel:W08D2.7 mtr-4; yeast MTR (mRNA TRansport) homolog family member (mtr-4); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1026 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 0/35 (0%) Query 92 FGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 + F LD FQK+AIL ++ NQ V V+AHTSAGKTVV Sbjct 122 YPFQLDAFQKQAILCIDNNQSVLVSAHTSAGKTVV 156 > cpv:cgd3_280 mRNA translation inhibitor SKI2 SFII helicase, DEXDc+HELICc ; K01509 adenosinetriphosphatase [EC:3.6.1.3] Length=1439 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 32/47 (68%), Gaps = 0/47 (0%) Query 80 DLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 D S + E + +++ + LDDFQKRA++ + V VAAHTSAGKT V Sbjct 112 DDSEDLENVVLKYPYELDDFQKRAVINIHNGDHVLVAAHTSAGKTAV 158 > dre:406795 skiv2l2, wu:fd11a05, zgc:63838; superkiller viralicidic activity 2-like 2 (EC:3.6.4.13); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1034 Score = 47.8 bits (112), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 91 EFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 E+ F LD FQ+ AIL ++ NQ V V+AHTSAGKTV Sbjct 123 EYPFILDPFQREAILCIDNNQSVLVSAHTSAGKTV 157 > tgo:TGME49_013770 RNA helicase, putative ; K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1206 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Query 85 EEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 +EP A ++ F LD FQ+R++L LE + V VAAHTSAGKTVV Sbjct 225 KEP-ARQYKFRLDAFQQRSVLCLEAGESVLVAAHTSAGKTVV 265 > ath:AT1G59760 ATP-dependent RNA helicase, putative; K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=988 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 32/98 (32%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Query 31 GSAALESALRAQVAPPPDAAAAAAAAAAAVTGAAAAAPTDTASPSTAAADLSP--EEEPL 88 GS +S + + PP + + D + P L+P +P Sbjct 2 GSVKRKSVEESSDSAPPQKVQREDDSTQIINEELVGCVHDVSFPENYVP-LAPSVHNKPP 60 Query 89 AIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 A +F F LD FQ AI L+ + V V+AHTSAGKTVV Sbjct 61 AKDFPFTLDSFQSEAIKCLDNGESVMVSAHTSAGKTVV 98 > cel:F01G4.3 hypothetical protein; K12599 antiviral helicase SKI2 [EC:3.6.4.-] Length=1266 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 31/39 (79%), Gaps = 0/39 (0%) Query 88 LAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 +A ++ F LD FQ+ ++L +E+ + +FVAAHTSAGKTVV Sbjct 285 MARKYPFSLDPFQQSSVLCMERGESLFVAAHTSAGKTVV 323 > mmu:72198 Skiv2l2, 2610528A15Rik, mKIAA0052; superkiller viralicidic activity 2-like 2 (S. cerevisiae) (EC:3.6.4.13); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1040 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%) Query 91 EFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 E+ F LD FQ+ AI ++ NQ V V+AHTSAGKTV Sbjct 133 EYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTV 167 > hsa:23517 SKIV2L2, Dob1, KIAA0052, MGC142069, Mtr4, fSAP118; superkiller viralicidic activity 2-like 2 (S. cerevisiae) (EC:3.6.4.13); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1042 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%) Query 91 EFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTV 125 E+ F LD FQ+ AI ++ NQ V V+AHTSAGKTV Sbjct 135 EYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTV 169 > sce:YJL050W MTR4, DOB1; ATP-dependent 3'-5' RNA helicase, involved in nuclear RNA processing and degredation both as a component of the TRAMP complex and in TRAMP independent processes; member of the Dead-box family of helicases (EC:3.6.1.-); K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1073 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 32/112 (28%), Positives = 42/112 (37%), Gaps = 26/112 (23%) Query 15 AAAAAARQQQQQAAAGGSAALESALRAQVAPPPDAAAAAAAAAAAVTGAAAAAPTDTASP 74 A+ + Q G L +R QVA PP+ A V A Sbjct 95 ASKGLTNSETLQVEQDGKVRLSHQVRHQVALPPNYDYTPIAEHKRVNEART--------- 145 Query 75 STAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 + F LD FQ AI +++ + V V+AHTSAGKTVV Sbjct 146 -----------------YPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVV 180 > cpv:cgd8_2520 Mtr4p like SKI family SFII helicase ; K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=1280 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Query 51 AAAAAAAAAVTGAAAAAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQKRAILRLEKN 110 + + APTD S D + ++ P A E+ F LD FQ +I LE Sbjct 58 SGTNCVHECIRPCGYVAPTD--SKLRVQYDENGKKIP-AKEYSFKLDTFQAVSIGCLEIG 114 Query 111 QCVFVAAHTSAGKTVV 126 + V ++AHTSAGKT V Sbjct 115 ESVLISAHTSAGKTCV 130 > ath:AT2G06990 HEN2; HEN2 (hua enhancer 2); ATP-dependent helicase/ RNA helicase; K12598 ATP-dependent RNA helicase DOB1 [EC:3.6.4.13] Length=995 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 7/95 (7%) Query 37 SALRAQVAPPPDAAAAAAAAAAAVTGAAAAAPTDTASPSTAAADLSPEEEP-----LAIE 91 S LR+ P P+ + A A P D +P+ + P +A Sbjct 20 SKLRSDETPTPEPRTKRRSLKRACV-HEVAVPND-YTPTKEETIHGTLDNPVFNGDMAKT 77 Query 92 FGFPLDDFQKRAILRLEKNQCVFVAAHTSAGKTVV 126 + F LD FQ ++ LE+ + + V+AHTSAGKT V Sbjct 78 YPFKLDPFQSVSVACLERKESILVSAHTSAGKTAV 112 Lambda K H 0.314 0.121 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2059772308 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40