bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0760_orf1 Length=79 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_119650 3' exoribonuclease, putative (EC:2.7.7.56); ... 65.5 4e-11 dre:326786 exosc6, id:ibd1130, wu:fe17d05, zgc:110071; exosome... 50.8 1e-06 ath:AT4G27490 3' exoribonuclease family domain 1-containing pr... 45.8 4e-05 cpv:cgd6_3540 archeo-eukaryotice exosomal RNAse PH 42.7 3e-04 bbo:BBOV_III011810 17.m10653; hypothetical protein 42.4 3e-04 mmu:72544 Exosc6, 2610510N21Rik, C76919, MGC151362, Mtr3; exos... 37.4 0.011 hsa:11340 EXOSC8, CIP3, EAP2, OIP2, RP11-421P11.3, RRP43, Rrp4... 36.2 0.024 hsa:118460 EXOSC6, EAP4, MTR3, Mtr3p, hMtr3p, p11; exosome com... 36.2 0.026 pfa:PFB0415c 3' exoribonuclease, putative 36.2 0.028 mmu:69639 Exosc8, 2310032N20Rik, CIP3, KIAA4013, mKIAA4013; ex... 35.0 0.061 dre:323016 exosc8, MGC174638, wu:fb79a10, zgc:110381; exosome ... 33.9 0.13 mmu:109075 Exosc4, 1110039I09Rik, 1500001N04Rik, Rrp41; exosom... 33.9 0.13 hsa:54512 EXOSC4, FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p... 33.9 0.13 mmu:100048741 exosome complex component rrp43-like; K12586 exo... 33.5 0.16 dre:393712 exosc4, MGC73175, zgc:73175; exosome component 4; K... 33.1 0.20 xla:379078 exosc8, MGC132146, MGC52847; exosome component 8; K... 32.7 0.28 ath:AT3G61620 RRP41; RRP41; 3'-5'-exoribonuclease/ RNA binding... 32.3 0.43 xla:496046 hypothetical LOC496046; K12586 exosome complex comp... 32.0 0.47 cel:Y6D11A.1 exos-4.2; EXOSome (multiexonuclease complex) comp... 32.0 0.55 xla:495942 exosc4; exosome component 4; K11600 exosome complex... 31.6 0.62 tgo:TGME49_031040 exosome complex exonuclease, putative ; K116... 31.2 0.93 cel:F37C12.13 exos-9; EXOSome (multiexonuclease complex) compo... 29.6 2.4 pfa:PF14_0256 exosome complex exonuclease rrp41, putative; K11... 29.3 3.6 tpv:TP01_1052 hypothetical protein 28.5 5.2 ath:AT3G07750 3' exoribonuclease family domain 1-containing pr... 27.7 9.8 > tgo:TGME49_119650 3' exoribonuclease, putative (EC:2.7.7.56); K11600 exosome complex component RRP41 Length=303 Score = 65.5 bits (158), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 29/59 (49%), Positives = 44/59 (74%), Gaps = 0/59 (0%) Query 3 KDIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSSPF 61 +++ M +QT +L +A+GSAFVS+G TK+ C+V+GPRP + QDRG I ++FR +PF Sbjct 54 EEMRAMCMQTHSLAAAAGSAFVSVGKTKLNCAVYGPRPNMKHASQDRGSINLEFRFAPF 112 > dre:326786 exosc6, id:ibd1130, wu:fe17d05, zgc:110071; exosome component 6 (EC:3.1.13.-); K12587 exosome complex component MTR3, animal type Length=271 Score = 50.8 bits (120), Expect = 1e-06, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Query 2 NKDIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQD--RGFIKVDFRSS 59 N D+ P+ + + A GSA++ GNTK+ CSV+GP+ R D D G + DFR + Sbjct 39 NGDVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLA 98 Query 60 PF 61 PF Sbjct 99 PF 100 > ath:AT4G27490 3' exoribonuclease family domain 1-containing protein Length=256 Score = 45.8 bits (107), Expect = 4e-05, Method: Composition-based stats. Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 0/38 (0%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRS 44 P LQT A+ SASGSA+ GNTKV SVFGPR + ++ Sbjct 45 PALLQTGAVSSASGSAYAEFGNTKVIVSVFGPRESKKA 82 > cpv:cgd6_3540 archeo-eukaryotice exosomal RNAse PH Length=303 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 37/59 (62%), Gaps = 0/59 (0%) Query 3 KDIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSSPF 61 +++ P+ ++T + +A GSA+ S+GNTKV C ++GP ++ ++D + V++ F Sbjct 54 EELRPITIRTGVIENADGSAYFSIGNTKVLCGIYGPNLCKQNPIEDGLSVSVEYTIGSF 112 > bbo:BBOV_III011810 17.m10653; hypothetical protein Length=196 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 0/43 (0%) Query 17 SASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSS 59 SASGS++++LG+T V V PRP G+ LQ+ G + ++ R S Sbjct 6 SASGSSYITLGDTMVKACVNVPRPCGKRLLQEVGILSIEVRYS 48 > mmu:72544 Exosc6, 2610510N21Rik, C76919, MGC151362, Mtr3; exosome component 6 (EC:3.1.13.-); K12587 exosome complex component MTR3, animal type Length=273 Score = 37.4 bits (85), Expect = 0.011, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 13/68 (19%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQD-------------RGFIK 53 P++ + L A GSA++ G TKV C+V GPR A + RG + Sbjct 38 PVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGSGPAGAGGEAPAALRGRLL 97 Query 54 VDFRSSPF 61 DFR +PF Sbjct 98 CDFRRAPF 105 > hsa:11340 EXOSC8, CIP3, EAP2, OIP2, RP11-421P11.3, RRP43, Rrp43p, bA421P11.3, p9; exosome component 8 (EC:3.1.13.-); K12586 exosome complex component RRP43 Length=276 Score = 36.2 bits (82), Expect = 0.024, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 10/57 (17%) Query 14 ALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFI--KVD--------FRSSP 60 ++ +A GSA V LGNT V C V A +D D+G++ VD FRS P Sbjct 41 SISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGP 97 > hsa:118460 EXOSC6, EAP4, MTR3, Mtr3p, hMtr3p, p11; exosome component 6; K12587 exosome complex component MTR3, animal type Length=272 Score = 36.2 bits (82), Expect = 0.026, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 13/68 (19%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQD-------------RGFIK 53 P++ + L A GSA++ G TKV C+V GPR A + RG + Sbjct 38 PVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLL 97 Query 54 VDFRSSPF 61 DFR +PF Sbjct 98 CDFRRAPF 105 > pfa:PFB0415c 3' exoribonuclease, putative Length=275 Score = 36.2 bits (82), Expect = 0.028, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 0/57 (0%) Query 2 NKDIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRS 58 N +I M ++ + S F SLGNTK+ +V+GP P + +G + +D +S Sbjct 38 NNEIRDMFIKLGEDENFGSSCFYSLGNTKILTTVYGPNPDSKYATYSKGKVFLDVKS 94 > mmu:69639 Exosc8, 2310032N20Rik, CIP3, KIAA4013, mKIAA4013; exosome component 8; K12586 exosome complex component RRP43 Length=280 Score = 35.0 bits (79), Expect = 0.061, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 14 ALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFI 52 ++ +A GSA V LGNT V C V A D DRG++ Sbjct 41 SISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYV 79 > dre:323016 exosc8, MGC174638, wu:fb79a10, zgc:110381; exosome component 8; K12586 exosome complex component RRP43 Length=277 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 0/46 (0%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFI 52 P L ++ +A GSA V +GNT V C + S+ Q++G++ Sbjct 34 PTTLNINSISTADGSALVKIGNTTVICGIKAELAVPPSEAQNKGYL 79 > mmu:109075 Exosc4, 1110039I09Rik, 1500001N04Rik, Rrp41; exosome component 4; K11600 exosome complex component RRP41 Length=245 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query 15 LGSASGSAFVSLGNTKVYCSVFGP---RPAGRSDLQDRGFIKVDFRSSPF 61 A GSA++ GNTK V+GP R + L DR + + S+ F Sbjct 32 FAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATF 81 > hsa:54512 EXOSC4, FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A; exosome component 4; K11600 exosome complex component RRP41 Length=245 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query 15 LGSASGSAFVSLGNTKVYCSVFGP---RPAGRSDLQDRGFIKVDFRSSPF 61 A GSA++ GNTK V+GP R + L DR + + S+ F Sbjct 32 FAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATF 81 > mmu:100048741 exosome complex component rrp43-like; K12586 exosome complex component RRP43 Length=418 Score = 33.5 bits (75), Expect = 0.16, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSV 35 P+H+ T +L A+GSA V G+T V C V Sbjct 110 PVHIHTSSLAHANGSALVRTGDTTVVCGV 138 > dre:393712 exosc4, MGC73175, zgc:73175; exosome component 4; K11600 exosome complex component RRP41 Length=245 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Query 15 LGSASGSAFVSLGNTKVYCSVFGP---RPAGRSDLQDRGFIKVDFRSSPF 61 A GSA++ GNTK V+GP R + L DR I + + F Sbjct 32 FAQADGSAYLEQGNTKALAVVYGPHEIRGSRSKSLHDRAIINCQYSMATF 81 > xla:379078 exosc8, MGC132146, MGC52847; exosome component 8; K01149 [EC:3.1.13.-] Length=276 Score = 32.7 bits (73), Expect = 0.28, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query 1 NNKDIPPMHLQTLALGS---ASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFR 57 + +++ T+ +GS A GSA V LGN V C V A +D D+G++ + Sbjct 25 DGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVKAELAAPPADSPDKGYVVPNVD 84 Query 58 SSPF 61 +P Sbjct 85 LTPL 88 > ath:AT3G61620 RRP41; RRP41; 3'-5'-exoribonuclease/ RNA binding; K11600 exosome complex component RRP41 Length=241 Score = 32.3 bits (72), Expect = 0.43, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 15 LGSASGSAFVSLGNTKVYCSVFGPR 39 + A GSA +GNTKV +V+GPR Sbjct 29 VSKADGSAVFEMGNTKVIAAVYGPR 53 > xla:496046 hypothetical LOC496046; K12586 exosome complex component RRP43 Length=276 Score = 32.0 bits (71), Expect = 0.47, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query 1 NNKDIPPMHLQTLALGS---ASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFR 57 + +++ T+ +GS A GSA V LGN V C V A +D ++G++ + Sbjct 25 DGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVKAEFAAPPADAPNKGYVVPNVD 84 Query 58 SSPF 61 SP Sbjct 85 LSPL 88 > cel:Y6D11A.1 exos-4.2; EXOSome (multiexonuclease complex) component family member (exos-4.2) Length=241 Score = 32.0 bits (71), Expect = 0.55, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query 2 NKDIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFR 57 N P+ ++ G+ GS + GNT+V + GP G+ + +DR I ++ + Sbjct 34 NTAFRPLCVKCGVFGAQDGSGYAEFGNTRVLAQITGPDGDGKWE-EDRAKITIELK 88 > xla:495942 exosc4; exosome component 4; K11600 exosome complex component RRP41 Length=249 Score = 31.6 bits (70), Expect = 0.62, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Query 15 LGSASGSAFVSLGNTKVYCSVFGP---RPAGRSDLQDRGFIKVDFRSSPF 61 A GSA++ GNTK V+GP R + L DR I + + F Sbjct 32 FAQADGSAYIEQGNTKALAVVYGPHEIRGSRSKMLHDRCVINCQYSMATF 81 > tgo:TGME49_031040 exosome complex exonuclease, putative ; K11600 exosome complex component RRP41 Length=352 Score = 31.2 bits (69), Expect = 0.93, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 18 ASGSAFVSLGNTKVYCSVFGPRP 40 A G + VS G+TKV VFGPRP Sbjct 83 ADGRSLVSFGSTKVAAFVFGPRP 105 > cel:F37C12.13 exos-9; EXOSome (multiexonuclease complex) component family member (exos-9); K12586 exosome complex component RRP43 Length=434 Score = 29.6 bits (65), Expect = 2.4, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 13 LALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSSP 60 L +G+ G+A ++GNTKV +V S +G I +D SP Sbjct 37 LVVGAEVGTAICTIGNTKVMAAVSAEIAEPSSMRPHKGVINIDVDLSP 84 > pfa:PF14_0256 exosome complex exonuclease rrp41, putative; K11600 exosome complex component RRP41 Length=246 Score = 29.3 bits (64), Expect = 3.6, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query 20 GSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSSPF 61 G +F +GNTK++ + GP R D ++ +K + SPF Sbjct 40 GFSFFEIGNTKLFAYIQGPNEYRRPD--EKCLVKCNVFLSPF 79 > tpv:TP01_1052 hypothetical protein Length=148 Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust. Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 0/60 (0%) Query 4 DIPPMHLQTLALGSASGSAFVSLGNTKVYCSVFGPRPAGRSDLQDRGFIKVDFRSSPFFQ 63 ++ P+ ++ + SGS +SLGNT C V P+ + + + G ++ S+ + Sbjct 16 ELRPLEIRMSTSSAFSGSCMISLGNTIAKCLVNLPKISTKKASTEYGQFTLELTSNYLYH 75 > ath:AT3G07750 3' exoribonuclease family domain 1-containing protein; K12589 exosome complex component RRP42 Length=286 Score = 27.7 bits (60), Expect = 9.8, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Query 7 PMHLQTLALGSASGSAFVSLGNTKVYCSVFGP--RPAGRSDLQ-DRGFIKVDFRSSP 60 P++++T + A+GSA V +G T V SV RP S LQ D+G + V SP Sbjct 31 PIYVETGVIPQANGSARVRIGGTDVIASVKAEIGRP---SSLQPDKGKVAVFIDCSP 84 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2063098576 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40