bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0315_orf3 Length=139 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_007820 mitogen-activated protein kinase, putative (... 108 7e-24 cpv:cgd2_4340 mitogen-activated protein kinase 2 ; K08293 mito... 82.0 5e-16 tpv:TP01_0359 mitogen-activated protein kinase 2; K08293 mitog... 75.1 6e-14 bbo:BBOV_IV005520 23.m06268; mitogen-activated protein kinase;... 72.8 3e-13 pfa:PF11_0147 map-2; mitogen-activated protein kinase 2; K0829... 64.3 1e-10 hsa:5595 MAPK3, ERK1, HS44KDAP, HUMKER1A, MGC20180, P44ERK1, P... 52.4 5e-07 cpv:cgd3_3030 MAPK ; K04371 extracellular signal-regulated kin... 49.3 4e-06 dre:360144 mapk1, zERK2; mitogen-activated protein kinase 1 (E... 48.9 5e-06 mmu:26417 Mapk3, Erk-1, Erk1, Ert2, Esrk1, Mnk1, Mtap2k, Prkm3... 48.9 5e-06 tgo:TGME49_033010 mitogen-activated protein kinase 2 (EC:2.7.1... 47.4 1e-05 xla:398985 mapk1-a, MGC68934, erk, erk2, mapk, mapk1, mapk1a, ... 47.0 2e-05 pfa:PFC0525c PfGSK-3, PfGSK3; glycogen synthase kinase 3; K030... 46.6 2e-05 xla:397785 mapk1-b, Xp42, erk, erk2, mapk, mapk1b, mpk1; mitog... 46.6 2e-05 dre:399480 mapk3, ERK1, fi06b09, wu:fi06b09, zERK1; mitogen-ac... 46.2 3e-05 dre:100330818 mitogen-activated protein kinase 3-like; K04371 ... 46.2 3e-05 cel:F43C1.2 mpk-1; MAP Kinase family member (mpk-1); K04371 ex... 46.2 3e-05 sce:YHR030C SLT2, BYC2, MPK1, SLK2; Serine/threonine MAP kinas... 45.8 4e-05 sce:YLR113W HOG1, SSK3; Hog1p (EC:2.7.11.24); K04441 p38 MAP k... 45.8 4e-05 xla:734485 mapk15, MGC99048; mitogen-activated protein kinase ... 45.8 4e-05 tpv:TP04_0659 casein kinase II subunit alpha (EC:2.7.1.37); K0... 45.8 4e-05 mmu:26413 Mapk1, 9030612K14Rik, AA407128, AU018647, C78273, ER... 45.4 6e-05 hsa:5594 MAPK1, ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2,... 45.4 6e-05 sce:YKL161C MLP1; Protein kinase implicated in the Slt2p mitog... 45.1 6e-05 cel:C05D10.2 hypothetical protein; K08293 mitogen-activated pr... 45.1 8e-05 cpv:cgd2_1960 mitogen-activated protein kinase 1, serine/threo... 44.3 1e-04 mmu:29857 Mapk12, AW123708, Erk6, P38gamma, Prkm12, Sapk3; mit... 43.9 1e-04 sce:YBL016W FUS3, DAC2; Fus3p (EC:2.7.11.24); K04371 extracell... 43.5 2e-04 xla:414522 nlk, MGC81364, Xnlk, nlk2; nemo-like kinase; K04468... 43.5 2e-04 mmu:18099 Nlk, AI194375; nemo like kinase (EC:2.7.11.24); K044... 43.5 2e-04 hsa:51701 NLK, DKFZp761G1211, FLJ21033; nemo-like kinase (EC:2... 43.5 2e-04 hsa:225689 MAPK15, ERK7, ERK8; mitogen-activated protein kinas... 43.5 2e-04 ath:AT2G46070 MPK12; MPK12 (MITOGEN-ACTIVATED PROTEIN KINASE 1... 43.5 2e-04 dre:563460 nlk2, nlka; nemo like kinase, type 2; K04468 nemo l... 43.1 2e-04 dre:65237 mapk14a, MAPK14, fk28c03, hm:zeh1243, p38, p38a, wu:... 43.1 3e-04 ath:AT2G18170 ATMPK7; ATMPK7 (ARABIDOPSIS THALIANA MAP KINASE ... 43.1 3e-04 ath:AT4G00720 ATSK32; ATSK32 (SHAGGY-LIKE PROTEIN KINASE 32); ... 42.7 3e-04 dre:565830 mapk6, erk3, p97mapk, si:ch211-235f12.1; mitogen-ac... 42.7 3e-04 ath:AT4G01370 ATMPK4; ATMPK4 (ARABIDOPSIS THALIANA MAP KINASE ... 42.7 3e-04 ath:AT1G01560 ATMPK11; MAP kinase/ kinase; K04371 extracellula... 42.7 3e-04 mmu:332110 Mapk15, BC048082, MGC56865, MGC56903; mitogen-activ... 42.4 4e-04 ath:AT4G36450 ATMPK14 (Mitogen-activated protein kinase 14); M... 42.4 4e-04 ath:AT3G59790 ATMPK10; MAP kinase/ kinase; K04371 extracellula... 42.4 4e-04 ath:AT1G10210 ATMPK1; ATMPK1 (MITOGEN-ACTIVATED PROTEIN KINASE... 42.0 6e-04 pfa:PFD0865c Pfcrk-1; cdc2-related protein kinase 1 42.0 xla:398295 nlk.2, nlk, xnlk; nemo-like kinase, gene 2 (EC:2.7.... 42.0 6e-04 dre:541323 mapk7, bmk1, erk5, wu:fb73b02, zgc:113111; mitogen-... 41.6 8e-04 cel:B0478.1 jnk-1; Jun N-terminal Kinase family member (jnk-1)... 41.6 8e-04 xla:494669 mapk11, p38-2, p38Beta, p38b, p38beta2, prkm11, sap... 41.6 8e-04 dre:405892 nlk1, nlk, nlkb, zgc:111875; nemo like kinase, type... 41.6 8e-04 ath:AT3G61160 shaggy-related protein kinase beta / ASK-beta (A... 41.2 9e-04 > tgo:TGME49_007820 mitogen-activated protein kinase, putative (EC:2.7.11.24); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=548 Score = 108 bits (269), Expect = 7e-24, Method: Composition-based stats. Identities = 56/134 (41%), Positives = 70/134 (52%), Gaps = 49/134 (36%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAPS 61 +A++LLKRMLVFNP +RI+++ECLAHPFFKEVR +E Sbjct 462 DAIHLLKRMLVFNPNKRITINECLAHPFFKEVRIAEVET--------------------- 500 Query 62 DGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQRF 121 A EKVRLPFNDW NMDEPQLR F++E+QR+ Sbjct 501 ----------------------------NATEKVRLPFNDWMNMDEPQLRYAFVKEIQRY 532 Query 122 HPNLQLPKTLLERA 135 HP +QLP+ RA Sbjct 533 HPEIQLPRRSPNRA 546 > cpv:cgd2_4340 mitogen-activated protein kinase 2 ; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=563 Score = 82.0 bits (201), Expect = 5e-16, Method: Composition-based stats. Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 49/130 (37%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAPS 61 ++++LLK+MLVFNP +RI+VDE L+H FK +RN Sbjct 478 QSIDLLKKMLVFNPNKRITVDEALSHSLFKNIRNEM------------------------ 513 Query 62 DGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQRF 121 L++ ++EKV LPF+DW++M E +LR FL+E+QRF Sbjct 514 -------------------------LEIISHEKVTLPFDDWSSMTERELRYFFLKEIQRF 548 Query 122 HPNLQLPKTL 131 P+L +P ++ Sbjct 549 SPDLVIPDSI 558 > tpv:TP01_0359 mitogen-activated protein kinase 2; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=642 Score = 75.1 bits (183), Expect = 6e-14, Method: Composition-based stats. Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 49/134 (36%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAPS 61 E+++LLK+ML FNP +RISV + L HP+FK + P Sbjct 558 ESIDLLKKMLTFNPDKRISVFDALNHPYFKSISK------------------------PR 593 Query 62 DGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQRF 121 + D P KV LPFNDW NM E QLR FLRE+QR+ Sbjct 594 NNF-------------DSIP------------KVTLPFNDWVNMSESQLRYSFLREIQRY 628 Query 122 HPNLQLPKTLLERA 135 H + ++P ++ R+ Sbjct 629 HKDFKIPVKIIYRS 642 > bbo:BBOV_IV005520 23.m06268; mitogen-activated protein kinase; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=584 Score = 72.8 bits (177), Expect = 3e-13, Method: Composition-based stats. Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 49/134 (36%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAP 60 P A+NLL++ML FNP +RI+V E L H +F+E P Sbjct 499 PAAVNLLQQMLTFNPYKRITVAEALKHEYFREFYKPQ----------------------- 535 Query 61 SDGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQR 120 HV + E++ PFNDW NM E QLR FLRE+QR Sbjct 536 -----------------------HVEI---PTEQLVTPFNDWINMSESQLRYAFLREIQR 569 Query 121 FHPNLQLPKTLLER 134 +HP ++P ++ + Sbjct 570 YHPEFKIPLKIIYK 583 > pfa:PF11_0147 map-2; mitogen-activated protein kinase 2; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=508 Score = 64.3 bits (155), Expect = 1e-10, Method: Composition-based stats. Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 49/130 (37%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAPS 61 E ++LL+ ML FN ++RI++D+ L+HP+ K+VR LE F+ Sbjct 418 EGIDLLESMLRFNAQKRITIDKALSHPYLKDVRKEN-----------------LENFS-- 458 Query 62 DGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQRF 121 EK+ LPF+DW + E QLR FL+E+Q F Sbjct 459 ------------------------------TEKIILPFDDWMVLSETQLRYIFLKEIQSF 488 Query 122 HPNLQLPKTL 131 H +L +P L Sbjct 489 HADLIIPAKL 498 > hsa:5595 MAPK3, ERK1, HS44KDAP, HUMKER1A, MGC20180, P44ERK1, P44MAPK, PRKM3; mitogen-activated protein kinase 3 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=357 Score = 52.4 bits (124), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 33/46 (71%), Gaps = 0/46 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAAL 47 +AL+LL RML FNP +RI+V+E LAHP+ ++ +P EV AA+ Sbjct 302 KALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQSPAAV 347 > cpv:cgd3_3030 MAPK ; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=566 Score = 49.3 bits (116), Expect = 4e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 28/33 (84%), Gaps = 0/33 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEV 33 PEA++L+++ML FNPK+RI+ +E L+HP+F + Sbjct 290 PEAIDLIEKMLSFNPKKRITAEEALSHPYFNGI 322 > dre:360144 mapk1, zERK2; mitogen-activated protein kinase 1 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=369 Score = 48.9 bits (115), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+AL+LL +ML FNP +RI V+E LAHP+ ++ +P E Sbjct 293 PKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDE 331 > mmu:26417 Mapk3, Erk-1, Erk1, Ert2, Esrk1, Mnk1, Mtap2k, Prkm3, p44, p44erk1, p44mapk; mitogen-activated protein kinase 3 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=380 Score = 48.9 bits (115), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 20/38 (52%), Positives = 29/38 (76%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 +AL+LL RML FNP +RI+V+E LAHP+ ++ +P E Sbjct 303 KALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDE 340 > tgo:TGME49_033010 mitogen-activated protein kinase 2 (EC:2.7.11.24); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=669 Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE-VC 41 PEAL+LLK++L FNP +RIS ++ L HP+ ++ +P E VC Sbjct 277 PEALDLLKQLLQFNPNKRISAEKGLEHPYVRQFHSPEDEPVC 318 > xla:398985 mapk1-a, MGC68934, erk, erk2, mapk, mapk1, mapk1a, mpk1, xp42; mitogen-activated protein kinase 1 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=361 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+AL+LL +ML FNP +RI V+ LAHP+ ++ +P+ E Sbjct 287 PKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDE 325 > pfa:PFC0525c PfGSK-3, PfGSK3; glycogen synthase kinase 3; K03083 glycogen synthase kinase 3 beta [EC:2.7.11.26] Length=440 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 0/55 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLE 56 EA+NL+ + L + P +R++ E LA PFF E+R+P I++ L LF FC E Sbjct 325 EAINLITQFLKYEPLKRLNPIEALADPFFDELRDPCIKLPKYIDKLPELFNFCKE 379 > xla:397785 mapk1-b, Xp42, erk, erk2, mapk, mapk1b, mpk1; mitogen-activated protein kinase 1 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=361 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+AL+LL +ML FNP +RI V+ LAHP+ ++ +P+ E Sbjct 287 PKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDE 325 > dre:399480 mapk3, ERK1, fi06b09, wu:fi06b09, zERK1; mitogen-activated protein kinase 3 (EC:2.7.11.1); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=392 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 30/38 (78%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 +AL+LL RML FNP +RI+V++ LAHP+ ++ +P+ E Sbjct 316 KALDLLDRMLTFNPLKRINVEQALAHPYLEQYYDPSDE 353 > dre:100330818 mitogen-activated protein kinase 3-like; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=392 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 30/38 (78%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 +AL+LL RML FNP +RI+V++ LAHP+ ++ +P+ E Sbjct 316 KALDLLDRMLTFNPLKRINVEQALAHPYLEQYYDPSDE 353 > cel:F43C1.2 mpk-1; MAP Kinase family member (mpk-1); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=444 Score = 46.2 bits (108), Expect = 3e-05, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE-VC 41 P AL+LL +ML FNP RI +++ LAHP+ ++ +P E VC Sbjct 355 PRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVC 396 > sce:YHR030C SLT2, BYC2, MPK1, SLK2; Serine/threonine MAP kinase involved in regulating the maintenance of cell wall integrity and progression through the cell cycle; regulated by the PKC1-mediated signaling pathway (EC:2.7.11.24); K04464 mitogen-activated protein kinase 7 [EC:2.7.11.24] Length=484 Score = 45.8 bits (107), Expect = 4e-05, Method: Composition-based stats. Identities = 21/41 (51%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE-VC 41 +AL+LL++ML F+P++RI+VDE L HP+ +PA E VC Sbjct 290 QALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVC 330 > sce:YLR113W HOG1, SSK3; Hog1p (EC:2.7.11.24); K04441 p38 MAP kinase [EC:2.7.11.24] Length=435 Score = 45.8 bits (107), Expect = 4e-05, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+A++LL++MLVF+PK+RI+ + LAHP+ +P E Sbjct 273 PDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDE 311 > xla:734485 mapk15, MGC99048; mitogen-activated protein kinase 15 (EC:2.7.11.24); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=586 Score = 45.8 bits (107), Expect = 4e-05, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALL 48 EAL+LL ++LVFNP +R++ +E L HP+ +PA E + + +L Sbjct 277 EALDLLSKLLVFNPGKRLTAEEALEHPYVSRFHSPAREPALDYDVIL 323 > tpv:TP04_0659 casein kinase II subunit alpha (EC:2.7.1.37); K03097 casein kinase II subunit alpha [EC:2.7.11.1] Length=420 Score = 45.8 bits (107), Expect = 4e-05, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 28/38 (73%), Gaps = 0/38 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAI 38 PE ++LL RMLV++ +RI+ E + HPFF E++N ++ Sbjct 383 PEVMDLLDRMLVYDHTKRITPLEAMEHPFFNEIKNNSV 420 > mmu:26413 Mapk1, 9030612K14Rik, AA407128, AU018647, C78273, ERK, Erk2, MAPK2, PRKM2, Prkm1, p41mapk, p42mapk; mitogen-activated protein kinase 1 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=358 Score = 45.4 bits (106), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 +AL+LL +ML FNP +RI V++ LAHP+ ++ +P+ E Sbjct 283 KALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE 320 > hsa:5594 MAPK1, ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk; mitogen-activated protein kinase 1 (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=360 Score = 45.4 bits (106), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 +AL+LL +ML FNP +RI V++ LAHP+ ++ +P+ E Sbjct 285 KALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE 322 > sce:YKL161C MLP1; Protein kinase implicated in the Slt2p mitogen-activated (MAP) kinase signaling pathway; associates with Rlm1p (EC:2.7.1.-); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=433 Score = 45.1 bits (105), Expect = 6e-05, Method: Composition-based stats. Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFF 30 PEAL LLK+ML F+PK+RI+V++ L HP+ Sbjct 289 PEALELLKKMLEFDPKKRITVEDALEHPYL 318 > cel:C05D10.2 hypothetical protein; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=470 Score = 45.1 bits (105), Expect = 8e-05, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 30/37 (81%), Gaps = 0/37 (0%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 A+++++R+L+F P++R++V++CL HP+ + NP+ E Sbjct 279 AIDMVQRLLIFAPQKRLTVEQCLVHPYVVQFHNPSEE 315 > cpv:cgd2_1960 mitogen-activated protein kinase 1, serine/threonine protein kinase Length=710 Score = 44.3 bits (103), Expect = 1e-04, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 EAL+LL ++L FNP +RIS ++ L HPF NP E Sbjct 306 EALDLLDKLLQFNPNKRISANDALKHPFVSIFHNPNEE 343 > mmu:29857 Mapk12, AW123708, Erk6, P38gamma, Prkm12, Sapk3; mitogen-activated protein kinase 12 (EC:2.7.11.24); K04441 p38 MAP kinase [EC:2.7.11.24] Length=367 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+A+NLL+RMLV + ++R++ E L HP+F+ +R+ E Sbjct 282 PQAVNLLERMLVLDAEQRVTAAEALTHPYFESLRDTEDE 320 > sce:YBL016W FUS3, DAC2; Fus3p (EC:2.7.11.24); K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=353 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+ ++LL+RMLVF+P +RI+ E L HP+ + +P E Sbjct 280 PKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE 318 > xla:414522 nlk, MGC81364, Xnlk, nlk2; nemo-like kinase; K04468 nemo like kinase [EC:2.7.11.24] Length=533 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVR 34 EA++LL RMLVF+P +RIS + LAHP+ E R Sbjct 405 EAVHLLCRMLVFDPSKRISAKDALAHPYLDEGR 437 > mmu:18099 Nlk, AI194375; nemo like kinase (EC:2.7.11.24); K04468 nemo like kinase [EC:2.7.11.24] Length=527 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVR 34 EA++LL RMLVF+P +RIS + LAHP+ E R Sbjct 399 EAVHLLCRMLVFDPSKRISAKDALAHPYLDEGR 431 > hsa:51701 NLK, DKFZp761G1211, FLJ21033; nemo-like kinase (EC:2.7.11.24); K04468 nemo like kinase [EC:2.7.11.24] Length=527 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVR 34 EA++LL RMLVF+P +RIS + LAHP+ E R Sbjct 399 EAVHLLCRMLVFDPSKRISAKDALAHPYLDEGR 431 > hsa:225689 MAPK15, ERK7, ERK8; mitogen-activated protein kinase 15 (EC:2.7.11.24); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=544 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 PEAL+LL+R+LVF P +R+S + L HP+ + P+ E Sbjct 275 PEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDE 313 > ath:AT2G46070 MPK12; MPK12 (MITOGEN-ACTIVATED PROTEIN KINASE 12); MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=372 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE-VC 41 A++LL+RMLVF+P RRISVDE L H + + A E VC Sbjct 300 AIDLLERMLVFDPNRRISVDEALGHAYLSPHHDVAKEPVC 339 > dre:563460 nlk2, nlka; nemo like kinase, type 2; K04468 nemo like kinase [EC:2.7.11.24] Length=452 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVR 34 EA++LL RMLVF+P +RIS + LAHP+ E R Sbjct 324 EAVHLLCRMLVFDPSKRISAKDALAHPYLDEGR 356 > dre:65237 mapk14a, MAPK14, fk28c03, hm:zeh1243, p38, p38a, wu:fk28c03, zp38a; mitogen-activated protein kinase 14a (EC:2.7.11.24); K04441 p38 MAP kinase [EC:2.7.11.24] Length=361 Score = 43.1 bits (100), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 28/39 (71%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P+A++LL++MLV + +RI+ E LAHP+F + +P E Sbjct 280 PQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDE 318 > ath:AT2G18170 ATMPK7; ATMPK7 (ARABIDOPSIS THALIANA MAP KINASE 7); MAP kinase/ kinase; K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=368 Score = 43.1 bits (100), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 32/127 (25%), Positives = 50/127 (39%), Gaps = 51/127 (40%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAP 60 P A++LL+RMLVF+P +RISV + L HP+ + +P Sbjct 290 PLAIDLLQRMLVFDPTKRISVTDALLHPYMAGLFDPG----------------------- 326 Query 61 SDGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQR 120 +P HVP+ + +E NM+EP +R EM Sbjct 327 ------------------SNPPAHVPISLDIDE----------NMEEPVIREMMWNEMLY 358 Query 121 FHPNLQL 127 +HP ++ Sbjct 359 YHPEAEI 365 > ath:AT4G00720 ATSK32; ATSK32 (SHAGGY-LIKE PROTEIN KINASE 32); ATP binding / kinase/ protein kinase/ protein serine/threonine kinase/ protein tyrosine kinase; K00924 [EC:2.7.1.-] Length=472 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAP 60 PEA++L+ R+L ++P R + E AHPFF ++R+P + + AL LF F + A Sbjct 393 PEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGR-ALPPLFNFTAQELA- 450 Query 61 SDGLCVHSSSTLFPA 75 G L PA Sbjct 451 --GASTELRQRLIPA 463 > dre:565830 mapk6, erk3, p97mapk, si:ch211-235f12.1; mitogen-activated protein kinase 6 (EC:2.7.1.-); K06855 mitogen-activated protein kinase 4/6 [EC:2.7.11.24] Length=729 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 0/44 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMH 44 PEAL+ L+++L FNP R++ +E LAHP+ + P E +H Sbjct 287 PEALDFLEKILTFNPMDRLTAEEALAHPYMSDYSFPLDEPVSLH 330 > ath:AT4G01370 ATMPK4; ATMPK4 (ARABIDOPSIS THALIANA MAP KINASE 4); MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=376 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 24/28 (85%), Gaps = 0/28 (0%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFF 30 A++LL++MLVF+P RRI+VDE L HP+ Sbjct 302 AVDLLEKMLVFDPSRRITVDEALCHPYL 329 > ath:AT1G01560 ATMPK11; MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=369 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/28 (60%), Positives = 24/28 (85%), Gaps = 0/28 (0%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFF 30 A++LL++MLVF+P RRI+VDE L HP+ Sbjct 299 AVDLLQKMLVFDPNRRITVDEALCHPYL 326 > mmu:332110 Mapk15, BC048082, MGC56865, MGC56903; mitogen-activated protein kinase 15 (EC:2.7.11.24); K08293 mitogen-activated protein kinase [EC:2.7.11.24] Length=549 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 PEAL+LLKR+L F P +R+S ++ L HP+ + P E Sbjct 276 PEALDLLKRLLAFAPDKRLSAEQALQHPYVQRFHCPDRE 314 > ath:AT4G36450 ATMPK14 (Mitogen-activated protein kinase 14); MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=361 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNP 36 P A++LL+RMLVF+P +RISV + L HP+ + + P Sbjct 287 PLAIDLLQRMLVFDPTKRISVSDALLHPYMEGLLEP 322 > ath:AT3G59790 ATMPK10; MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=393 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 17/30 (56%), Positives = 25/30 (83%), Gaps = 0/30 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFF 30 P A++L+++ML F+PK+RISV E LAHP+ Sbjct 316 PLAIDLVEKMLTFDPKQRISVKEALAHPYL 345 > ath:AT1G10210 ATMPK1; ATMPK1 (MITOGEN-ACTIVATED PROTEIN KINASE 1); MAP kinase/ kinase; K04371 extracellular signal-regulated kinase 1/2 [EC:2.7.11.24] Length=370 Score = 42.0 bits (97), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNP 36 A++LL++MLVF+P +RISV E L HP+ + +P Sbjct 292 AIDLLQKMLVFDPSKRISVSEALQHPYMAPLYDP 325 > pfa:PFD0865c Pfcrk-1; cdc2-related protein kinase 1 Length=699 Score = 42.0 bits (97), Expect = 6e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 3 ALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNP 36 L+LL++ML +NP+ RIS E L HP+F E P Sbjct 629 GLDLLQKMLHYNPQCRISAQEALNHPYFNEFPKP 662 > xla:398295 nlk.2, nlk, xnlk; nemo-like kinase, gene 2 (EC:2.7.11.24); K04468 nemo like kinase [EC:2.7.11.24] Length=447 Score = 42.0 bits (97), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMH 44 EA++LL RML+F+P +RIS + LAHP+ +E R CM H Sbjct 321 EAVHLLCRMLLFDPLKRISAKDALAHPYLEEGRL-RYHTCMCH 362 > dre:541323 mapk7, bmk1, erk5, wu:fb73b02, zgc:113111; mitogen-activated protein kinase 7 (EC:2.7.1.-); K04464 mitogen-activated protein kinase 7 [EC:2.7.11.24] Length=862 Score = 41.6 bits (96), Expect = 8e-04, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE-VCM 42 P ALNLL ML F+P+ RIS + L HP+ + +P E VC+ Sbjct 344 PSALNLLAAMLRFDPRERISACQALEHPYLSKYHDPDDEPVCV 386 > cel:B0478.1 jnk-1; Jun N-terminal Kinase family member (jnk-1); K04440 c-Jun N-terminal kinase [EC:2.7.11.24] Length=463 Score = 41.6 bits (96), Expect = 8e-04, Method: Composition-based stats. Identities = 17/28 (60%), Positives = 23/28 (82%), Gaps = 0/28 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPF 29 +A +LL RMLV +P+RRISVD+ L HP+ Sbjct 386 QARDLLSRMLVIDPERRISVDDALRHPY 413 > xla:494669 mapk11, p38-2, p38Beta, p38b, p38beta2, prkm11, sapk2, sapk2b; mitogen-activated protein kinase 11; K04441 p38 MAP kinase [EC:2.7.11.24] Length=361 Score = 41.6 bits (96), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 0/39 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIE 39 P A++LL++ML+ + +RIS E LAHP+F + +P E Sbjct 278 PLAIDLLEKMLILDSDKRISATEALAHPYFVQYHDPDDE 316 > dre:405892 nlk1, nlk, nlkb, zgc:111875; nemo like kinase, type 1; K04468 nemo like kinase [EC:2.7.11.24] Length=475 Score = 41.6 bits (96), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVR 34 EA++LL RMLVF+P +RIS + L+HP+ E R Sbjct 349 EAVHLLCRMLVFDPAKRISGSDALSHPYLDEGR 381 > ath:AT3G61160 shaggy-related protein kinase beta / ASK-beta (ASK2) Length=431 Score = 41.2 bits (95), Expect = 9e-04, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 0/36 (0%) Query 1 PEALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNP 36 PEA++L R+L ++P R + E AHPFF ++R+P Sbjct 357 PEAMDLASRLLQYSPNLRCTALEACAHPFFDDLRDP 392 Lambda K H 0.326 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2487377096 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40