bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0191_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070530 ubiquitin fusion degradation domain-containi... 138 4e-33 ath:AT2G21270 ubiquitin fusion degradation UFD1 family protein... 115 3e-26 tpv:TP02_0530 hypothetical protein; K14016 ubiquitin fusion de... 110 8e-25 pfa:PF14_0178 UFD1; Ubiquitin fusion degradation protein UFD1,... 109 3e-24 ath:AT2G29070 ubiquitin fusion degradation UFD1 family protein 107 1e-23 ath:AT4G38930 ubiquitin fusion degradation UFD1 family protein 105 3e-23 bbo:BBOV_II005920 18.m06490; ubiquitin fusion degradation prot... 104 5e-23 cpv:cgd4_1200 ubiquitin fusion degradation protein (UFD1); dou... 100 9e-22 hsa:7353 UFD1L, UFD1; ubiquitin fusion degradation 1 like (yea... 97.4 1e-20 mmu:22230 Ufd1l, Ufd1; ubiquitin fusion degradation 1 like; K1... 97.4 1e-20 dre:436724 ufd1l, wu:fc55f04, zgc:92341; ubiquitin fusion degr... 97.4 1e-20 xla:399034 ufd1l, MGC68571, ufd1; ubiquitin fusion degradation... 86.3 2e-17 cel:F19B6.2 ufd-1; Ubiquitin Fusion Degradation (yeast UFD hom... 83.2 2e-16 ath:AT4G15420 PRLI-interacting factor K 72.4 4e-13 sce:YGR048W UFD1; Protein that interacts with Cdc48p and Npl4p... 68.9 4e-12 bbo:BBOV_IV011730 23.m05946; ubiquitin fusion degradation prot... 59.3 3e-09 pfa:PFI0810c apicoplast Ufd1 precursor 49.3 3e-06 pfa:PFE1235c Ubiquitin fusion degradation protein UFD1, putative 41.2 9e-04 cpv:cgd2_3150 ubiquitin fusion degradation (UFD1) family prote... 33.9 0.14 dre:497399 im:7140212 32.0 0.50 mmu:22635 Zan; zonadhesin 31.2 0.73 sce:YER172C BRR2, PRP44, RSS1, SLT22, SNU246; Brr2p (EC:3.6.1.... 30.8 1.1 ath:AT4G35560 hypothetical protein 30.0 2.1 xla:100127323 hypothetical protein LOC100127323 29.6 2.5 cel:T09A12.4 nhr-66; Nuclear Hormone Receptor family member (n... 29.3 3.0 hsa:401827 MSLNL, C16orf37, MPFL; mesothelin-like 28.9 4.0 cel:T21D12.9 hypothetical protein 28.5 5.8 > tgo:TGME49_070530 ubiquitin fusion degradation domain-containing protein (EC:3.1.3.48); K14016 ubiquitin fusion degradation protein 1 Length=335 Score = 138 bits (347), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 67/99 (67%), Positives = 82/99 (82%), Gaps = 0/99 (0%) Query 1 ALEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPF 60 LEEG IV V N+SLPKGTFV+LQP+ T+FL +SNP+A+LE+ALRGYAALT G+++ LPF Sbjct 103 GLEEGDIVRVRNISLPKGTFVELQPVTTEFLQVSNPRAVLEVALRGYAALTVGDLIYLPF 162 Query 61 LDCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNPS 99 LD + L V DLRPAPAVSI+ETD+EVEFKAPE P+ Sbjct 163 LDKGFQLLVTDLRPAPAVSIIETDMEVEFKAPEGYVEPT 201 > ath:AT2G21270 ubiquitin fusion degradation UFD1 family protein; K14016 ubiquitin fusion degradation protein 1 Length=319 Score = 115 bits (288), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 0/120 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG IV V NV+LPKGT+V+LQP TDFLDISNPKA+LE ALR Y+ LT G+ + +P+ Sbjct 94 LQEGDIVRVRNVTLPKGTYVKLQPHTTDFLDISNPKAILETALRNYSCLTSGDSIMVPYN 153 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNPSPVPDPAADGGYISSDEASEPPE 121 + Y + + + +PA A+SI+ETD EV+F P + + P P+A G ++E + PE Sbjct 154 NKKYFIDIVETKPANAISIIETDCEVDFAPPLDYKEPERPTAPSAAKGPAKAEEVVDEPE 213 > tpv:TP02_0530 hypothetical protein; K14016 ubiquitin fusion degradation protein 1 Length=260 Score = 110 bits (276), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 54/112 (48%), Positives = 76/112 (67%), Gaps = 9/112 (8%) Query 6 GIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVY 65 +VT+TNVSLPK T+V+L+PL D+ DISNP+A+LE ALR YA LT G+V+ + ++ +Y Sbjct 102 NVVTITNVSLPKATWVKLKPLNEDYWDISNPRAVLENALRNYATLTVGDVIPIHYIQTIY 161 Query 66 HLRVADLRPAPAVSIVETDVEVEFKA----PEEQQN-----PSPVPDPAADG 108 + DL+PA A SI+ETD+EVEF P+E++N P P+ DG Sbjct 162 LFHIMDLKPAKACSIIETDMEVEFDMPVPEPKEEENDMETDPEPIIGKRLDG 213 > pfa:PF14_0178 UFD1; Ubiquitin fusion degradation protein UFD1, putative; K14016 ubiquitin fusion degradation protein 1 Length=282 Score = 109 bits (272), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 0/97 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG IV VT+VSLPKGTFV+L+P DF+++SN +A+LE ALR YA LT G+ + + +L Sbjct 103 LKEGDIVRVTSVSLPKGTFVKLKPCSKDFMELSNHRAVLETALRNYATLTIGDNIVIHYL 162 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNP 98 Y +++ DL+PA A +I+ETDVEVEF+ P + P Sbjct 163 GKTYEIKIVDLKPAFACTIIETDVEVEFEEPIDHSEP 199 > ath:AT2G29070 ubiquitin fusion degradation UFD1 family protein Length=280 Score = 107 bits (267), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 48/98 (48%), Positives = 71/98 (72%), Gaps = 0/98 (0%) Query 1 ALEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPF 60 +LEEG ++ V N+SL KGT+++LQP DFLDISNPKA+LE LR Y+ LT G+ + +P+ Sbjct 56 SLEEGDVMQVKNISLVKGTYIKLQPHTQDFLDISNPKAILETTLRSYSCLTTGDTIMVPY 115 Query 61 LDCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNP 98 + Y++ V + +P+ AVSI+ETD EV+F P + + P Sbjct 116 NNKQYYINVVEAKPSSAVSIIETDCEVDFAPPLDYKEP 153 > ath:AT4G38930 ubiquitin fusion degradation UFD1 family protein Length=311 Score = 105 bits (263), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 48/97 (49%), Positives = 71/97 (73%), Gaps = 0/97 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG +V V NV+LPKGT+V+LQP TDFLDI+NPKA+LE ALR Y+ LT G+ + +P+ Sbjct 94 LQEGDMVRVRNVTLPKGTYVKLQPHTTDFLDIANPKAILETALRNYSCLTVGDSIMVPYN 153 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNP 98 + Y + + + +P+ +SI+ETD EV+F P + + P Sbjct 154 NKKYFIDIVEAKPSNGISIIETDCEVDFAPPLDYKEP 190 > bbo:BBOV_II005920 18.m06490; ubiquitin fusion degradation protein; K14016 ubiquitin fusion degradation protein 1 Length=258 Score = 104 bits (260), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 53/109 (48%), Positives = 72/109 (66%), Gaps = 2/109 (1%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG +T+ NV LPK +V+ +PL ++ DISNPKA+LE ALR +A LT G+ + + +L Sbjct 104 LQEGDYLTIRNVRLPKANWVKFRPLNDNYWDISNPKAVLETALRNFATLTIGDRIPIHYL 163 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQ--QNPSPVPDPAADG 108 VY L V DLRPA A I+ETD+EVEF +++ Q PVP DG Sbjct 164 SNVYELDVMDLRPADACCIIETDMEVEFAETKKKKPQLVQPVPGKRLDG 212 > cpv:cgd4_1200 ubiquitin fusion degradation protein (UFD1); double Psi beta barrel fold ; K14016 ubiquitin fusion degradation protein 1 Length=322 Score = 100 bits (250), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 0/91 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG I ++ N SL KGT+V+ PL DFLDISNPKA+LE LR +A LT G+++++ + Sbjct 125 LQEGDITSIMNTSLSKGTYVKFMPLSMDFLDISNPKAVLETTLRNFATLTVGDIITIHYN 184 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAP 92 + Y + V + +P A+SI+ETD++V+F P Sbjct 185 NNSYRINVLETKPNNAISIIETDIQVDFAPP 215 > hsa:7353 UFD1L, UFD1; ubiquitin fusion degradation 1 like (yeast); K14016 ubiquitin fusion degradation protein 1 Length=266 Score = 97.4 bits (241), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 46/91 (50%), Positives = 66/91 (72%), Gaps = 0/91 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 LEEGG+V V +V+L T+ + QP DFLDI+NPKA+LE ALR +A LT G+V+++ + Sbjct 104 LEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYN 163 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAP 92 + +Y LRV + +P AVSI+E D+ V+F AP Sbjct 164 EKIYELRVMETKPDKAVSIIECDMNVDFDAP 194 > mmu:22230 Ufd1l, Ufd1; ubiquitin fusion degradation 1 like; K14016 ubiquitin fusion degradation protein 1 Length=307 Score = 97.4 bits (241), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 46/91 (50%), Positives = 66/91 (72%), Gaps = 0/91 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 LEEGG+V V +V+L T+ + QP DFLDI+NPKA+LE ALR +A LT G+V+++ + Sbjct 104 LEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYN 163 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAP 92 + +Y LRV + +P AVSI+E D+ V+F AP Sbjct 164 EKIYELRVMETKPDKAVSIIECDMNVDFDAP 194 > dre:436724 ufd1l, wu:fc55f04, zgc:92341; ubiquitin fusion degradation 1-like; K14016 ubiquitin fusion degradation protein 1 Length=308 Score = 97.4 bits (241), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 46/91 (50%), Positives = 66/91 (72%), Gaps = 0/91 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 LEEGG+V V +V+L T+ + QP DFLDI+NPKA+LE ALR +A LT G+V+++ + Sbjct 104 LEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYN 163 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAP 92 + +Y LRV + +P AVSI+E D+ V+F AP Sbjct 164 EKIYELRVMETKPDKAVSIIECDMNVDFDAP 194 > xla:399034 ufd1l, MGC68571, ufd1; ubiquitin fusion degradation 1 like; K14016 ubiquitin fusion degradation protein 1 Length=307 Score = 86.3 bits (212), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%) Query 10 VTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVYHLRV 69 V +V+L T+ + QP DFLDI+NPKA+LE ALR +A LT G+VV++ + + +Y LRV Sbjct 112 VESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVVAINYNEKIYELRV 171 Query 70 ADLRPAPAVSIVETDVEVEFKAP 92 + +P AVSI+E D+ V+F AP Sbjct 172 METKPDKAVSIIECDMNVDFDAP 194 > cel:F19B6.2 ufd-1; Ubiquitin Fusion Degradation (yeast UFD homolog) family member (ufd-1); K14016 ubiquitin fusion degradation protein 1 Length=342 Score = 83.2 bits (204), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/93 (40%), Positives = 60/93 (64%), Gaps = 0/93 (0%) Query 1 ALEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPF 60 L++G + + + +LPK TF +L+P+ +FL+I+NPKA+LE+ LR YA LTK + + + Sbjct 107 GLDDGDTIRIESATLPKATFAKLKPMSLEFLNITNPKAVLEVELRKYACLTKNDRIPTSY 166 Query 61 LDCVYHLRVADLRPAPAVSIVETDVEVEFKAPE 93 V DL+PA +V I+E DV ++F PE Sbjct 167 AGQTLEFLVVDLKPANSVCIIECDVNLDFDPPE 199 > ath:AT4G15420 PRLI-interacting factor K Length=561 Score = 72.4 bits (176), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 0/87 (0%) Query 7 IVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVYH 66 +V + + LPKG++ +LQP F D+ N KA+LE LR +A L+ +V+ + + Y Sbjct 166 LVEIRYIRLPKGSYAKLQPDNLGFSDLPNHKAILETILRQHATLSLDDVLLVNYGQVSYK 225 Query 67 LRVADLRPAPAVSIVETDVEVEFKAPE 93 L+V +LRPA ++S++ETD+EV+ +P+ Sbjct 226 LQVLELRPATSISVLETDIEVDIVSPD 252 > sce:YGR048W UFD1; Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol; K14016 ubiquitin fusion degradation protein 1 Length=361 Score = 68.9 bits (167), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 29/95 (30%), Positives = 61/95 (64%), Gaps = 3/95 (3%) Query 1 ALEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPF 60 ++ G ++ +++ +P G FV+L+P DFLDIS+PKA+LE LR ++ LT +V+ + + Sbjct 105 GIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISY 164 Query 61 LDCVYHLRVADLRP---APAVSIVETDVEVEFKAP 92 + +++ +++P + ++ ++ETD+ +F P Sbjct 165 NGKTFKIKILEVKPESSSKSICVIETDLVTDFAPP 199 > bbo:BBOV_IV011730 23.m05946; ubiquitin fusion degradation protein UFD1 Length=297 Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 5/87 (5%) Query 8 VTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVYHL 67 V VT + L FV + P+E+ F +S PKA+LE L+ Y++LT+G + + YHL Sbjct 208 VYVTQLKLQDAIFVSISPVESSFFALSAPKAVLEEHLKQYSSLTRGTTIQITHEGITYHL 267 Query 68 RVADL-----RPAPAVSIVETDVEVEF 89 RV + + A SI +TDV ++ Sbjct 268 RVNRIETEHCKDAECASIQDTDVSIDL 294 > pfa:PFI0810c apicoplast Ufd1 precursor Length=296 Score = 49.3 bits (116), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 5/88 (5%) Query 7 IVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVYH 66 ++ + V L + V LQP E F D+ NPK +LE LR Y+ +T+ +S+ D VY+ Sbjct 202 VIRLRFVKLETASSVVLQPHEKKFFDLENPKKILEEKLRYYSCITRNSTISIKHDDVVYY 261 Query 67 LRVADL-----RPAPAVSIVETDVEVEF 89 V + + SI + DV +F Sbjct 262 FDVIRIDSEKKKDTEVASIQDADVIFDF 289 > pfa:PFE1235c Ubiquitin fusion degradation protein UFD1, putative Length=700 Score = 41.2 bits (95), Expect = 9e-04, Method: Composition-based stats. Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 5/82 (6%) Query 8 VTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALR-GYAALTKGEVVSLPFLDCVYH 66 V +T L K F++L L + DI K LLE L Y+ LT G+ + + L+ Sbjct 158 VLITYCILSKCDFIKLDSLNNNINDIKYMKNLLENELSLNYSTLTLGDYIHINHLN---- 213 Query 67 LRVADLRPAPAVSIVETDVEVE 88 +++L P AVS++ TD+ V+ Sbjct 214 FYISELEPDNAVSLINTDINVD 235 > cpv:cgd2_3150 ubiquitin fusion degradation (UFD1) family protein, double Psi beta barrel fold Length=658 Score = 33.9 bits (76), Expect = 0.14, Method: Composition-based stats. Identities = 26/108 (24%), Positives = 54/108 (50%), Gaps = 9/108 (8%) Query 8 VTVTNVSLPKGTFVQLQPLET-DFLDISNPKALLEMALRG-YAALTKGE--VVSLPFLD- 62 + +T L KG+F + L D + + ++LLE LR + LT G+ +++ P Sbjct 196 IQITYKKLLKGSFASFEILNNQDIFKMHDIESLLESYLRNHFLTLTIGDTLMINQPNYSS 255 Query 63 ---CVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNPSPVPDPAAD 107 C+ ++V L P ++S++ TD+ ++ ++ +N + D A + Sbjct 256 NNYCISLIKVKHLEPDNSISLINTDISLDITY-KDSKNEQTIQDHAEN 302 > dre:497399 im:7140212 Length=825 Score = 32.0 bits (71), Expect = 0.50, Method: Composition-based stats. Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 6/90 (6%) Query 19 TFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCVYHLRVADLRPAPAV 78 T+ L+P F+D L+ G L+K +V LP L+ +L A RP ++ Sbjct 16 TYRILKPWWDVFMDYIGVIMLMLAIFSGTMQLSKDQVACLPILEKNINLEGAQNRPECSL 75 Query 79 SIVETDVEVEFKAPEEQQN------PSPVP 102 S++ T P+ N P+P+P Sbjct 76 SVLGTGPSTTKDLPDSVANELLNTQPAPLP 105 > mmu:22635 Zan; zonadhesin Length=5420 Score = 31.2 bits (69), Expect = 0.73, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Query 54 EVVSLPFLDCVYHLRVADLRPA-PAVSIVET-DVEVEFKAPEEQQNPSPVPDPAADGGYI 111 EV ++P H V ++ P +V ET EV +PEE P+ VP + + + Sbjct 708 EVPTVPTEVTGVHTEVTNVSPEETSVPTEETISTEVTTVSPEETTLPTEVPTVSTEVTNV 767 Query 112 SSDEASEPPE 121 S +E S PPE Sbjct 768 SPEETSVPPE 777 Score = 31.2 bits (69), Expect = 0.73, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Query 54 EVVSLPFLDCVYHLRVADLRPA-PAVSIVET-DVEVEFKAPEEQQNPSPVPDPAADGGYI 111 EV ++P H V ++ P +V ET EV +PEE P+ VP + + + Sbjct 787 EVPTVPTEVTGVHTEVTNVSPEETSVPTEETISTEVTTVSPEETTLPTEVPTVSTEVTNV 846 Query 112 SSDEASEPPE 121 S +E S PPE Sbjct 847 SPEETSVPPE 856 > sce:YER172C BRR2, PRP44, RSS1, SLT22, SNU246; Brr2p (EC:3.6.1.-); K12854 pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13] Length=2163 Score = 30.8 bits (68), Expect = 1.1, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 10/58 (17%) Query 3 EEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNP-KALLEMALRGYAALTKGEVVSLP 59 E ++TVT VSLP+G+F +++P + D + I P K +++ L+ E+ SLP Sbjct 436 ESSKLMTVTKVSLPEGSFKRVKP-QYDEIHIPAPSKPVIDYELK--------EITSLP 484 > ath:AT4G35560 hypothetical protein Length=1049 Score = 30.0 bits (66), Expect = 2.1, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Query 14 SLPKGTFVQLQPLETDFLDI----SNPKALLEMALRGYAALTKGEVVSLPF 60 SLPK T V+L ++ + + +NP LL ++ YA L K V LPF Sbjct 387 SLPKETVVKLPFSDSSSITVGKFLTNPSHLLNLSDEDYAQLAKDAVPFLPF 437 > xla:100127323 hypothetical protein LOC100127323 Length=426 Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Query 57 SLPFLDCVYHLRVADLRPAPAVSIVETDVEVEFKAP-EEQQNPSPVPDPAADGGY-ISSD 114 S PFLD V H R + P+ A + D V F P + N + D GGY S Sbjct 149 SYPFLDTVDHTRRPKILPSSATDLPRIDAIVLFGEPIRWETNLQLIIDVLLTGGYPASHH 208 Query 115 EASEPPE 121 +A+ P Sbjct 209 QAASYPH 215 > cel:T09A12.4 nhr-66; Nuclear Hormone Receptor family member (nhr-66) Length=733 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Query 64 VYHLRVADLRPAPAVSIVETDVEVEFKAP------EEQQNPSPVPDPAADGGYISSDEAS 117 ++ LRV DL PA A DVE +P E +Q PSPV P A G D+ Sbjct 665 MHMLRVFDLIPADACFNQMLDVESVNVSPDGQKDSEAEQGPSPVSVPEAARGSYQDDDM- 723 Query 118 EPP 120 PP Sbjct 724 -PP 725 > hsa:401827 MSLNL, C16orf37, MPFL; mesothelin-like Length=1053 Score = 28.9 bits (63), Expect = 4.0, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 12 NVSLPKGTFVQLQPLETDFLDISNPKALL 40 N+S+ TF L PLE LD+ N ALL Sbjct 881 NISMDIDTFTSLNPLELQSLDVGNVTALL 909 > cel:T21D12.9 hypothetical protein Length=881 Score = 28.5 bits (62), Expect = 5.8, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 0/51 (0%) Query 14 SLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFLDCV 64 SLP G+F L+ LE L ++ +L + AL G ++L K ++ S CV Sbjct 329 SLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCV 379 Lambda K H 0.312 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2013067560 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40