bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0128_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value pfa:PFL2075c conserved Plasmodium protein; K12848 U4/U6.U5 tri... 76.6 3e-14 tgo:TGME49_075310 hypothetical protein 76.6 3e-14 bbo:BBOV_II002560 18.m06206; hypothetical protein; K12848 U4/U... 72.0 6e-13 xla:495824 zmat2, snu23; zinc finger, matrin-type 2; K12848 U4... 70.1 2e-12 mmu:66492 Zmat2, 2610510D14Rik, 2900082I05Rik; zinc finger, ma... 70.1 2e-12 hsa:153527 ZMAT2, FLJ31121, Snu23, hSNU23; zinc finger, matrin... 70.1 2e-12 tpv:TP04_0385 hypothetical protein; K12848 U4/U6.U5 tri-snRNP ... 69.7 3e-12 dre:324476 zmat2, fc30d10, flj31121, wu:fc30d10; zinc finger, ... 68.6 6e-12 ath:AT3G05760 nucleic acid binding / zinc ion binding; K12848 ... 68.6 6e-12 cel:ZK686.4 hypothetical protein; K12848 U4/U6.U5 tri-snRNP co... 64.3 1e-10 cpv:cgd3_1060 U1 like C2H2 zinc finger ; K12848 U4/U6.U5 tri-s... 47.0 2e-05 ath:AT5G10800 RNA recognition motif (RRM)-containing protein 32.7 0.44 dre:327495 acin1b, acinus, acinusb, fi14c05, wu:fe06a10, wu:fi... 31.2 1.2 dre:567465 zfr2, MGC174987, si:ch211-63j24.3, wu:fb99a09, zfr;... 31.2 1.3 xla:734413 larp1, MGC98945; La ribonucleoprotein domain family... 30.8 1.7 hsa:25792 CIZ1, LSFR1, NP94, ZNF356; CDKN1A interacting zinc f... 30.0 2.6 dre:334173 baz1a, fi34e04, wu:fi34e04; bromodomain adjacent to... 28.9 6.5 > pfa:PFL2075c conserved Plasmodium protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=242 Score = 76.6 bits (187), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 29/46 (63%), Positives = 38/46 (82%), Gaps = 0/46 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAAL 46 +C IC+C+ KDSQ YLDHING+NHNR+LG SM+V++V+L VK L Sbjct 113 YCKICDCVLKDSQTYLDHINGKNHNRMLGYSMKVKKVTLDDVKKRL 158 > tgo:TGME49_075310 hypothetical protein Length=551 Score = 76.6 bits (187), Expect = 3e-14, Method: Composition-based stats. Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 4/117 (3%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQ--AERLALEAGGE 58 WCD+CECL KDS AY+DHINGRNHNR+LGM+MRVER + + V + L+ + LE GG+ Sbjct 364 WCDVCECLIKDSAAYMDHINGRNHNRMLGMTMRVERAAPSSVISRLREMQRQSQLELGGD 423 Query 59 QLNPKITVDAPLKQHQP--GGGGSQGAAGGIGSLPTGGAIEEGAPEAEDEFERAKRR 113 ++ +K Q G +Q + + + G G E D+ +R KRR Sbjct 424 DEGEAGSLSGDVKSQQSFDAPGAAQRGSVTRAAAASAGCAPGGIEENYDDIDRIKRR 480 > bbo:BBOV_II002560 18.m06206; hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=232 Score = 72.0 bits (175), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 0/47 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQ 47 +C C+C+ KDSQAY+DH+NGR HNR+LGM+MRVE+V V AL+ Sbjct 99 YCKTCDCILKDSQAYMDHLNGRKHNRMLGMTMRVEKVDHKAVAEALR 145 > xla:495824 zmat2, snu23; zinc finger, matrin-type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQAERLALE 54 +C++C+C+ KDS +LDHING+ H R LGMSMRVER +L +VK + + +E Sbjct 81 YCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKME 134 > mmu:66492 Zmat2, 2610510D14Rik, 2900082I05Rik; zinc finger, matrin type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQAERLALE 54 +C++C+C+ KDS +LDHING+ H R LGMSMRVER +L +VK + + +E Sbjct 81 YCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKME 134 > hsa:153527 ZMAT2, FLJ31121, Snu23, hSNU23; zinc finger, matrin-type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=199 Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQAERLALE 54 +C++C+C+ KDS +LDHING+ H R LGMSMRVER +L +VK + + +E Sbjct 81 YCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKME 134 > tpv:TP04_0385 hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=259 Score = 69.7 bits (169), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 0/47 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQ 47 +C C CL KDS++YLDH+NG+ HNRLLGM+MRVE+VS V L+ Sbjct 97 FCKTCNCLLKDSKSYLDHLNGKKHNRLLGMTMRVEKVSAKAVADKLR 143 > dre:324476 zmat2, fc30d10, flj31121, wu:fc30d10; zinc finger, matrin type 2; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=198 Score = 68.6 bits (166), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQA 48 +C++C+C+ KDS +LDHING+ H R LGMSMRVER SL +VK + Sbjct 80 YCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFEV 127 > ath:AT3G05760 nucleic acid binding / zinc ion binding; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=202 Score = 68.6 bits (166), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 0/48 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQA 48 +C +C+C+ KDS YLDHING+ H R LGMSMRVER SL +V+ + Sbjct 84 FCRVCDCVVKDSANYLDHINGKKHQRALGMSMRVERSSLEQVQERFEV 131 > cel:ZK686.4 hypothetical protein; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=217 Score = 64.3 bits (155), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVK 43 +CD+C+C+ KDS +LDHING+NH R +GMSM+ ++ ++A V+ Sbjct 91 YCDVCDCVVKDSINFLDHINGKNHQRNIGMSMKTKKSTVADVR 133 > cpv:cgd3_1060 U1 like C2H2 zinc finger ; K12848 U4/U6.U5 tri-snRNP component SNU23 Length=198 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 0/46 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAAL 46 WC++C DS +++ H+N ++HN+ +G S+ VE+ SL VK L Sbjct 84 WCEVCNLGFNDSHSWIRHLNSQSHNQKMGTSLYVEKKSLESVKRRL 129 > ath:AT5G10800 RNA recognition motif (RRM)-containing protein Length=947 Score = 32.7 bits (73), Expect = 0.44, Method: Compositional matrix adjust. Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 12/116 (10%) Query 41 RVKAALQAERLALEAGGEQLNPKITVDAPLKQHQPGGGGSQGAAGGIGS-LPTGGAIEEG 99 R K + RL LE + K+ D+ ++ + G S+ + + S LP A + Sbjct 45 RFKGIMLQLRLLLEVTINPNDNKLKPDSQGEKSRDGDSISKKGSRYVPSFLPPPLASKGK 104 Query 100 APEAEDEFERAK-----------RRLEELEREQELKKQRKKERKKAAAAGGGNTAS 144 PE + + ER+K +EEL+REQE++++R ++R+ + NT+S Sbjct 105 GPENKRDEERSKEMEKGKTRNIDHFVEELKREQEIRERRNQDRENSRDHNSDNTSS 160 > dre:327495 acin1b, acinus, acinusb, fi14c05, wu:fe06a10, wu:fi14c05; apoptotic chromatin condensation inducer 1b; K12875 apoptotic chromatin condensation inducer in the nucleus Length=1259 Score = 31.2 bits (69), Expect = 1.2, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 108 ERAKRRLEELEREQELKKQRKKERKKAAAAGGGNTA 143 ER KRR E E E + +K+R++ER K GGNTA Sbjct 1159 EREKRRKEIFEEEDKKRKEREQERAKGRDRVGGNTA 1194 > dre:567465 zfr2, MGC174987, si:ch211-63j24.3, wu:fb99a09, zfr; zinc finger RNA binding protein 2 Length=999 Score = 31.2 bits (69), Expect = 1.3, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 WCDICECLCKDSQAYLDHINGRNHNR 26 +CDIC+ C Q Y +H+ G+ H + Sbjct 314 YCDICKISCAGPQTYREHLEGQKHKK 339 Score = 28.9 bits (63), Expect = 6.1, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 2 CDICECLCKDSQAYLDHINGRNHNRLLGMSMRV 34 C++C+ C + AY HI G H +++ + ++ Sbjct 363 CELCDVSCTGADAYAAHIRGSKHQKVVKLHTKL 395 > xla:734413 larp1, MGC98945; La ribonucleoprotein domain family, member 1 Length=1021 Score = 30.8 bits (68), Expect = 1.7, Method: Composition-based stats. Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 7/89 (7%) Query 53 LEAGGEQLNPKITVDAPLKQH-------QPGGGGSQGAAGGIGSLPTGGAIEEGAPEAED 105 ++AGG +N ++ VD P+ +P G G G + PT G I + + Sbjct 69 MKAGGSTVNGQLPVDPPVPAKVVKAGNPRPRRGSKVGDFGDATNWPTPGEIAHKSVQPSS 128 Query 106 EFERAKRRLEELEREQELKKQRKKERKKA 134 + + +++ L + E ++E ++ +R K+ Sbjct 129 KLQPSRKSLGKKEMKEESADGKENQRVKS 157 > hsa:25792 CIZ1, LSFR1, NP94, ZNF356; CDKN1A interacting zinc finger protein 1 Length=842 Score = 30.0 bits (66), Expect = 2.6, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query 1 WCDICECLCKDSQAYLDHINGRNHNRLLGMSMRVERVSLARVKAALQAERLALEAGGEQL 60 +C IC+ C Q + DH++ H + LG ++ +S A + + L R LE E+ Sbjct 538 FCYICKASCSSQQEFQDHMSEPQHQQRLG---EIQHMSQACLLSLLPVPRDVLETEDEEP 594 Query 61 NPK 63 P+ Sbjct 595 PPR 597 > dre:334173 baz1a, fi34e04, wu:fi34e04; bromodomain adjacent to zinc finger domain, 1A; K11655 bromodomain adjacent to zinc finger domain protein 1A Length=711 Score = 28.9 bits (63), Expect = 6.5, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 110 AKRRLEELEREQELKKQRKKERKKAAAAGGGNTA 143 ++R EE REQELK + K ER K A GG A Sbjct 647 VRKRKEEKLREQELKLKEKHERLKEEAKNGGQLA 680 Lambda K H 0.312 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2814663556 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40