bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0049_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value cpv:cgd4_1920 hypothetical protein ; K12603 CCR4-NOT transcrip... 76.6 2e-14 pfa:PFE0980c CCR4; K12603 CCR4-NOT transcription complex subun... 74.7 7e-14 tgo:TGME49_059560 endonuclease/exonuclease/phosphatase domain-... 70.9 9e-13 mmu:231464 Cnot6l, 4932442K20Rik, DKFZp434K098, MGC29037; CCR4... 42.4 3e-04 hsa:246175 CNOT6L, CCR4b; CCR4-NOT transcription complex, subu... 42.4 3e-04 ath:AT3G58560 endonuclease/exonuclease/phosphatase family prot... 42.4 4e-04 xla:432104 cnot6l-a, MGC81488, ccr4b; CCR4-NOT transcription c... 42.4 4e-04 dre:553665 cnot6l, MGC111987, zgc:111987; CCR4-NOT transcripti... 41.6 6e-04 ath:AT3G58580 hydrolase 41.6 6e-04 xla:495050 cnot6l-b, ccr4b; CCR4-NOT transcription complex, su... 41.6 6e-04 cel:ZC518.3 ccr-4; CCR (yeast CCR4/NOT complex component) homo... 39.7 0.002 hsa:57472 CNOT6, CCR4, KIAA1194; CCR4-NOT transcription comple... 39.3 0.003 dre:560386 zgc:171797; K12603 CCR4-NOT transcription complex s... 39.3 0.003 tgo:TGME49_101220 hypothetical protein 38.9 0.004 ath:AT5G11350 endonuclease/exonuclease/phosphatase family protein 38.5 0.005 dre:324048 cnot6, KIAA1194, wu:fa03c11, wu:fc17f01, zgc:65822;... 37.4 0.012 mmu:104625 Cnot6, A230103N10Rik, AA407540, AW456442, CCR4, MGC... 37.0 0.014 mmu:211948 Pde12, 2'-PDE, E430028B21Rik; phosphodiesterase 12 36.2 dre:692319 2'-pde; zgc:136374 35.8 0.030 pfa:PFA_0355w PFA0355w:exon:1; carbon catabolite repressor pro... 35.8 0.033 ath:AT1G31500 endonuclease/exonuclease/phosphatase family protein 35.8 0.038 sce:YAL021C CCR4, FUN27, NUT21; Ccr4p (EC:3.1.13.4); K12603 CC... 35.4 0.045 hsa:201626 PDE12, 2'-PDE; phosphodiesterase 12 35.4 ath:AT1G73875 endonuclease/exonuclease/phosphatase family protein 34.7 0.069 ath:AT3G18500 hypothetical protein 32.3 0.39 tpv:TP01_0498 hypothetical protein 32.3 0.39 ath:AT2G48110 REF4; REF4 (REDUCED EPIDERMAL FLUORESCENCE 4) 29.3 2.8 dre:494454 fgf5; fibroblast growth factor 5; K04358 fibroblast... 29.3 3.1 pfa:PFC0850c endonuclease/exonuclease/phosphatase family prote... 29.3 3.3 ath:AT1G31530 endonuclease/exonuclease/phosphatase family protein 28.9 4.1 dre:100002795 novel protein similar to vertebrate rabphilin 3A... 28.9 4.1 ath:AT2G37460 nodulin MtN21 family protein 28.5 4.7 tgo:TGME49_004410 endonuclease/exonuclease/phosphatase domain-... 28.5 5.1 cel:R17.2 hypothetical protein 28.5 5.4 hsa:23070 FTSJD2, FLJ22156, KIAA0082, MTr1, hMTr1; FtsJ methyl... 28.1 6.7 ath:AT1G16460 ATRDH2; ATRDH2 (ARABIDOPSIS THALIANA RHODANESE H... 28.1 7.8 mmu:60425 Doc2g, D830013O18Rik; double C2, gamma 27.7 8.4 bbo:BBOV_II004670 18.m06391; endonuclease/exonuclease/phosphat... 27.7 9.6 > cpv:cgd4_1920 hypothetical protein ; K12603 CCR4-NOT transcription complex subunit 6 Length=782 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/79 (44%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Query 18 KMQHSLQLASAYALGRALLDVEE-NDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLE 76 ++ HS++L SAY++ +A+++ N V LEP+FTNYTPN++GCLDY+F++ L Sbjct 676 QLGHSMRLRSAYSMAKAMVEGHNPNMLVSSTESLEPVFTNYTPNYLGCLDYVFYTDERLR 735 Query 77 LVGILEPIFEQQLIREGSS 95 L G+LE + E+ LIRE ++ Sbjct 736 LGGVLELLDEEALIREAAA 754 > pfa:PFE0980c CCR4; K12603 CCR4-NOT transcription complex subunit 6 Length=2488 Score = 74.7 bits (182), Expect = 7e-14, Method: Composition-based stats. Identities = 46/116 (39%), Positives = 67/116 (57%), Gaps = 16/116 (13%) Query 1 HQSVNPQQHKEVLPLHWKMQHSLQLASAYALGRAL---LDVEENDGVEVYRQLEPIFTNY 57 H+ N ++ + L K+ H+L L SAYA+ + L L+ EE + +E+Y EP+FTNY Sbjct 2367 HEDFNSDKYSLLTDL--KLGHNLNLKSAYAISKLLSQKLNPEEYNNLELY---EPLFTNY 2421 Query 58 TPNFVGCLDYIFFSPFNLELVGILEPIFEQQLIREGSSSSSATAKTYCLCMCFFPS 113 T NF+GCLDYIF++ NL ++ + E QLI+E A+ Y L C PS Sbjct 2422 TSNFIGCLDYIFYNDENLNIISTVNVADENQLIQE--------AQMYQLSDCALPS 2469 > tgo:TGME49_059560 endonuclease/exonuclease/phosphatase domain-containing protein (EC:3.1.11.2 3.1.13.4); K12603 CCR4-NOT transcription complex subunit 6 Length=1347 Score = 70.9 bits (172), Expect = 9e-13, Method: Composition-based stats. Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 0/75 (0%) Query 19 MQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELV 78 + HS+ L S YA+ +AL D + RQ EP FTNYT N+ GCLDY+FF L + Sbjct 1243 LGHSIPLKSGYAVSKALKDGLDPHDFYALRQSEPEFTNYTGNYTGCLDYLFFCDTMLRVR 1302 Query 79 GILEPIFEQQLIREG 93 ILEPI +QL+RE Sbjct 1303 EILEPIDSKQLLREA 1317 > mmu:231464 Cnot6l, 4932442K20Rik, DKFZp434K098, MGC29037; CCR4-NOT transcription complex, subunit 6-like; K12603 CCR4-NOT transcription complex subunit 6 Length=555 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H QL SAY EN+ L P +TNYT +F G +DYIF+S ++ + Sbjct 459 RITHGFQLKSAY----------ENN-------LMP-YTNYTFDFKGVIDYIFYSKTHMNV 500 Query 78 VGILEPIFEQQLI 90 +G+L P+ Q L+ Sbjct 501 LGVLGPLDPQWLV 513 > hsa:246175 CNOT6L, CCR4b; CCR4-NOT transcription complex, subunit 6-like; K12603 CCR4-NOT transcription complex subunit 6 Length=555 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H QL SAY EN+ L P +TNYT +F G +DYIF+S ++ + Sbjct 459 RITHGFQLKSAY----------ENN-------LMP-YTNYTFDFKGVIDYIFYSKTHMNV 500 Query 78 VGILEPIFEQQLI 90 +G+L P+ Q L+ Sbjct 501 LGVLGPLDPQWLV 513 > ath:AT3G58560 endonuclease/exonuclease/phosphatase family protein; K12603 CCR4-NOT transcription complex subunit 6 Length=602 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Query 12 VLPLHWKMQHSLQLASAYA----LGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDY 67 +L H K+ H L L SAY+ +G ++ ++ ++ EP+FTN T +F+G LDY Sbjct 488 ILRPHSKLTHQLPLVSAYSQFAKMGGNVITEQQRRRLDPASS-EPLFTNCTRDFIGTLDY 546 Query 68 IFFSPFNLEL 77 IF++ L + Sbjct 547 IFYTADTLTV 556 > xla:432104 cnot6l-a, MGC81488, ccr4b; CCR4-NOT transcription complex, subunit 6-like; K12603 CCR4-NOT transcription complex subunit 6 Length=550 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H QL SAY EN+ L P +TNYT +F G +DYIF+S ++++ Sbjct 454 RITHGFQLRSAY----------ENN-------LMP-YTNYTFDFKGVIDYIFYSKTHMDV 495 Query 78 VGILEPIFEQQLI 90 +GIL P+ Q ++ Sbjct 496 LGILGPLDPQWMM 508 > dre:553665 cnot6l, MGC111987, zgc:111987; CCR4-NOT transcription complex, subunit 6-like; K12603 CCR4-NOT transcription complex subunit 6 Length=559 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 18/71 (25%) Query 19 MQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELV 78 + HS QL SAY E N L P +TNYT +F G +DYIFFS ++ ++ Sbjct 455 ITHSFQLKSAY---------EGN--------LMP-YTNYTYDFKGVIDYIFFSKTHMSVL 496 Query 79 GILEPIFEQQL 89 G+L P+ Q L Sbjct 497 GVLGPLETQWL 507 > ath:AT3G58580 hydrolase Length=603 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 12/72 (16%) Query 12 VLPLHWKMQHSLQLASAYA--LGRALLDVEENDGVEVYRQL------EPIFTNYTPNFVG 63 +L H K+ H L L SAY+ + + ++ + G+E +R+ EP+FTN T +F+G Sbjct 491 ILRPHTKLTHQLPLVSAYSSFVRKGIMGL----GLEQHRRRIDLNTNEPLFTNCTRDFIG 546 Query 64 CLDYIFFSPFNL 75 DYIF++ L Sbjct 547 THDYIFYTADTL 558 > xla:495050 cnot6l-b, ccr4b; CCR4-NOT transcription complex, subunit 6-like; K12603 CCR4-NOT transcription complex subunit 6 Length=550 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H QL SAY EN+ L P +TNYT +F G +DYIF+S ++++ Sbjct 454 RITHGFQLRSAY----------ENN-------LMP-YTNYTFDFKGVIDYIFYSKTHIDV 495 Query 78 VGILEPIFEQQLI 90 +G+L P+ Q ++ Sbjct 496 LGVLGPLDPQWMM 508 > cel:ZC518.3 ccr-4; CCR (yeast CCR4/NOT complex component) homolog family member (ccr-4); K12603 CCR4-NOT transcription complex subunit 6 Length=613 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGILEPIFEQQLIR 91 FTNYT +F G +DYIF +P +L +GIL P F+ Q ++ Sbjct 514 FTNYTLDFKGMIDYIFATPQSLARLGILGP-FDPQWVQ 550 > hsa:57472 CNOT6, CCR4, KIAA1194; CCR4-NOT transcription complex, subunit 6; K12603 CCR4-NOT transcription complex subunit 6 Length=557 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 18/79 (22%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H +L SAY G L P +TNYT +F G +DYIF+S L Sbjct 461 RITHGFKLQSAYESG-----------------LMP-YTNYTFDFKGIIDYIFYSKPQLNT 502 Query 78 VGILEPIFEQQLIREGSSS 96 +GIL P+ L+ S Sbjct 503 LGILGPLDHHWLVENNISG 521 > dre:560386 zgc:171797; K12603 CCR4-NOT transcription complex subunit 6 Length=558 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 18/78 (23%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H+ +L SAY G L P +TNYT +F G +DYIF+S L + Sbjct 462 RITHAFKLKSAYENG-----------------LMP-YTNYTFDFRGVIDYIFYSRPQLNV 503 Query 78 VGILEPIFEQQLIREGSS 95 +G+L P+ L+ S Sbjct 504 LGVLGPLDTNWLLENNIS 521 > tgo:TGME49_101220 hypothetical protein Length=469 Score = 38.9 bits (89), Expect = 0.004, Method: Composition-based stats. Identities = 15/20 (75%), Positives = 17/20 (85%), Gaps = 0/20 (0%) Query 51 EPIFTNYTPNFVGCLDYIFF 70 EP FTNYT +F GCLDY+FF Sbjct 408 EPRFTNYTRDFQGCLDYLFF 427 > ath:AT5G11350 endonuclease/exonuclease/phosphatase family protein Length=754 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 8/76 (10%) Query 14 PLHWKMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPF 73 P ++H+L+L S Y+ + + +G EP+ T+Y F+G +DYI+ S Sbjct 654 PERTTVEHALELKSTYSEVEGQANTRDENG-------EPVVTSYHRCFMGTVDYIWRSE- 705 Query 74 NLELVGILEPIFEQQL 89 L+ V +L PI +Q + Sbjct 706 GLQTVRVLAPIPKQAM 721 > dre:324048 cnot6, KIAA1194, wu:fa03c11, wu:fc17f01, zgc:65822; CCR4-NOT transcription complex, subunit 6; K12603 CCR4-NOT transcription complex subunit 6 Length=557 Score = 37.4 bits (85), Expect = 0.012, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H +L SAY G L P +TNYT +F G +DYIF+S L + Sbjct 461 RITHGFKLKSAYENG-----------------LMP-YTNYTFDFKGIIDYIFYSQPLLNV 502 Query 78 VGILEPIFEQQLI 90 +G+L P+ L+ Sbjct 503 LGVLGPLEHHWLL 515 > mmu:104625 Cnot6, A230103N10Rik, AA407540, AW456442, CCR4, MGC98472; CCR4-NOT transcription complex, subunit 6; K12603 CCR4-NOT transcription complex subunit 6 Length=552 Score = 37.0 bits (84), Expect = 0.014, Method: Compositional matrix adjust. Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 18/79 (22%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H +L SAY G L P +TNYT +F G +DYIF+S L Sbjct 456 RITHGFKLKSAYENG-----------------LMP-YTNYTFDFKGIIDYIFYSKPQLNT 497 Query 78 VGILEPIFEQQLIREGSSS 96 + IL P+ L+ S Sbjct 498 LAILGPLDHHWLVENNISG 516 > mmu:211948 Pde12, 2'-PDE, E430028B21Rik; phosphodiesterase 12 Length=608 Score = 36.2 bits (82), Expect = 0.027, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 51 EPIFTNYTPNFVGCLDYIFFSPFNLELVGIL 81 EP +TNY F GCLDYIF LE+ ++ Sbjct 545 EPAYTNYVGGFHGCLDYIFIDLNTLEVEQVI 575 > dre:692319 2'-pde; zgc:136374 Length=591 Score = 35.8 bits (81), Expect = 0.030, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 52 PIFTNYTPNFVGCLDYIFFSPFNLELVGIL 81 P FTN+ F GCLDYIF P L++ ++ Sbjct 525 PDFTNFVGGFQGCLDYIFVEPRTLQVEQVI 554 > pfa:PFA_0355w PFA0355w:exon:1; carbon catabolite repressor protein 4, putative Length=322 Score = 35.8 bits (81), Expect = 0.033, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 51 EPIFTNYTPNFVGCLDYIFFS 71 EP FTN TP+F GC+DYIF+ Sbjct 263 EPEFTNKTPSFEGCIDYIFYK 283 > ath:AT1G31500 endonuclease/exonuclease/phosphatase family protein Length=417 Score = 35.8 bits (81), Expect = 0.038, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Query 45 EVYRQLEPIFTNYTPNFVGCLDYIFFSPFN-LELVGILE 82 EV R EP FTN TP F LDYIF SP + ++ V IL+ Sbjct 346 EVTRG-EPKFTNCTPGFTNTLDYIFISPSDFIKPVSILQ 383 > sce:YAL021C CCR4, FUN27, NUT21; Ccr4p (EC:3.1.13.4); K12603 CCR4-NOT transcription complex subunit 6 Length=837 Score = 35.4 bits (80), Expect = 0.045, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGIL 81 FTN+TP+F +DYI+FS L + G+L Sbjct 768 FTNFTPSFTDVIDYIWFSTHALRVRGLL 795 > hsa:201626 PDE12, 2'-PDE; phosphodiesterase 12 Length=609 Score = 35.4 bits (80), Expect = 0.048, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 51 EPIFTNYTPNFVGCLDYIFFSPFNLELVGIL 81 EP +TNY F GCLDYIF LE+ ++ Sbjct 546 EPAYTNYVGGFHGCLDYIFIDLNALEVEQVI 576 > ath:AT1G73875 endonuclease/exonuclease/phosphatase family protein Length=454 Score = 34.7 bits (78), Expect = 0.069, Method: Compositional matrix adjust. Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 8/91 (8%) Query 19 MQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELV 78 +QH L+L SAY+ + G EP+ T Y F+G +DYI+ + L V Sbjct 363 VQHQLKLNSAYSGVPGTYRTRDQRG-------EPLATTYHSRFLGTVDYIWHTK-ELVPV 414 Query 79 GILEPIFEQQLIREGSSSSSATAKTYCLCMC 109 +LE + L R G S + C Sbjct 415 RVLETLPADVLRRTGGLPSENWGSDHLAIAC 445 > ath:AT3G18500 hypothetical protein Length=448 Score = 32.3 bits (72), Expect = 0.39, Method: Compositional matrix adjust. Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Query 21 HSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFS 71 H L+L S+YA + + ++ G EP+ T+Y F+G +DY+++S Sbjct 360 HPLKLNSSYASVKGSANTRDSVG-------EPLATSYHSKFLGTVDYLWYS 403 > tpv:TP01_0498 hypothetical protein Length=698 Score = 32.3 bits (72), Expect = 0.39, Method: Compositional matrix adjust. Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 13/71 (18%) Query 23 LQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELVGILE 82 L+L+SAYA+G + EP FT + GC+DYI + P ++L I E Sbjct 618 LKLSSAYAMGDSF-------------NSEPAFTAFHGWQRGCVDYICYDPSLVQLEAIYE 664 Query 83 PIFEQQLIREG 93 + R G Sbjct 665 MPHYSHVRRNG 675 > ath:AT2G48110 REF4; REF4 (REDUCED EPIDERMAL FLUORESCENCE 4) Length=1275 Score = 29.3 bits (64), Expect = 2.8, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 4 VNPQQHKEVLPLHWKMQHSLQLASA 28 + Q K V PLHW +Q L LASA Sbjct 18 IRSAQEKNVDPLHWALQLRLTLASA 42 > dre:494454 fgf5; fibroblast growth factor 5; K04358 fibroblast growth factor Length=225 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 0/40 (0%) Query 72 PFNLELVGILEPIFEQQLIREGSSSSSATAKTYCLCMCFF 111 P + +L G E QL+ EG S T + YC F Sbjct 14 PRSAQLTGRERAYLEHQLVEEGRVSGRRTGRLYCRVGIGF 53 > pfa:PFC0850c endonuclease/exonuclease/phosphatase family protein, putative Length=906 Score = 29.3 bits (64), Expect = 3.3, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query 47 YRQLEPIFTNYTPNFVGCLDYIFFSPFNLELVGILEPI 84 Y + + FTN+ NF+ LDYIF S N+++ +L+ I Sbjct 841 YTKQDIQFTNWNNNFIDVLDYIFLST-NIKVRKVLKGI 877 > ath:AT1G31530 endonuclease/exonuclease/phosphatase family protein Length=283 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 47 YRQLEPIFTNYTPNFVGCLDYIFFS 71 + + EP FTN P F LDY+F++ Sbjct 217 FTKGEPRFTNNVPGFAETLDYMFYT 241 > dre:100002795 novel protein similar to vertebrate rabphilin 3A homolog (mouse) (RPH3A) Length=429 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 77 LVGILEPIFEQQLIREGSSSSSATAKTYCLCMC 109 L L P++ + LI G +++ T KT LC+C Sbjct 196 LKNTLNPVWNETLIYHGITAADMTTKTLRLCVC 228 > ath:AT2G37460 nodulin MtN21 family protein Length=380 Score = 28.5 bits (62), Expect = 4.7, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 73 FNLELVGILEPIFEQQLIREGSSSSSATAKT 103 F + L+G+LEP+ +Q L G ++AT T Sbjct 79 FKISLLGLLEPVIDQNLYYLGMKYTTATFAT 109 > tgo:TGME49_004410 endonuclease/exonuclease/phosphatase domain-containing protein (EC:3.1.13.4) Length=1002 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 51 EPIFTNYTPNFVGCLDYIFFSPFNLELVGILE 82 EP FT Y GC+DYIF+ +L++ I + Sbjct 937 EPAFTAYHGWQKGCIDYIFYHSKSLDVARIYQ 968 > cel:R17.2 hypothetical protein Length=628 Score = 28.5 bits (62), Expect = 5.4, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 5/23 (21%) Query 52 PIFTNYTPN-----FVGCLDYIF 69 P +TNYT + FVGCLDYI+ Sbjct 564 PEYTNYTASSQKDGFVGCLDYIW 586 > hsa:23070 FTSJD2, FLJ22156, KIAA0082, MTr1, hMTr1; FtsJ methyltransferase domain containing 2 (EC:2.1.1.57); K14589 cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [EC:2.1.1.57] Length=835 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 64 CLDYIFFSPFNLELVGILEPIFEQQLIREGSSSSSATAKTYCLC 107 C + F+PF++ LV +L FE+ + + +S A ++ Y +C Sbjct 403 CKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVC 446 > ath:AT1G16460 ATRDH2; ATRDH2 (ARABIDOPSIS THALIANA RHODANESE HOMOLOGUE 2); 3-mercaptopyruvate sulfurtransferase/ thiosulfate sulfurtransferase (EC:2.8.1.1); K01011 thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2] Length=318 Score = 28.1 bits (61), Expect = 7.8, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 19 MQHSLQLASAYALGRALLDVEENDGVEVYRQL 50 ++H L A+A G + L +E NDGV VY + Sbjct 79 LRHMLPSEEAFAAGCSALGIENNDGVVVYDGM 110 > mmu:60425 Doc2g, D830013O18Rik; double C2, gamma Length=387 Score = 27.7 bits (60), Expect = 8.4, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 79 GILEPIFEQQLIREGSSSSSATAKTYCLCMC 109 G EP++E+ L G + A KT LC+C Sbjct 143 GTREPVWEETLTYHGFTCQDAGRKTLRLCVC 173 > bbo:BBOV_II004670 18.m06391; endonuclease/exonuclease/phosphatase family protein Length=597 Score = 27.7 bits (60), Expect = 9.6, Method: Compositional matrix adjust. Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Query 9 HKEVLPLHWKMQH--SLQLASAYALGR--ALLDVEENDGV-EVYRQLEPIFTNYTPNFVG 63 H+ +P Q+ S + Y+ G L+V G + Y E FTN+ F G Sbjct 491 HERFIPSAQNKQYLDSRMNGTPYSFGEQSERLEVPNYQGYHDAYSGHELPFTNFVKTFSG 550 Query 64 CLDYIFFS 71 LDYIF S Sbjct 551 TLDYIFHS 558 Lambda K H 0.321 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2008132680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40