bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0042_orf2 Length=106 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_112100 Ca2+-ATPase (EC:3.6.3.8); K05850 Ca2+ transp... 77.8 7e-15 dre:100150181 tmtc3; transmembrane and tetratricopeptide repea... 32.0 0.46 ath:AT4G20860 FAD-binding domain-containing protein 29.6 2.6 pfa:MAL13P1.19 peptidase, putative 28.5 4.8 cpv:cgd5_3370 hypothetical protein 28.5 5.3 > tgo:TGME49_112100 Ca2+-ATPase (EC:3.6.3.8); K05850 Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8] Length=1822 Score = 77.8 bits (190), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 34/67 (50%), Positives = 51/67 (76%), Gaps = 0/67 (0%) Query 13 PQCFPRITRMFPEFGMREEDLSEKASLALGLRGRSPSRMNDRCMISTLAVAKKYARRAKV 72 P+ FP + ++ PEFG REE L E SLAL LRGR+P RMN+R +++ AKKYA++A++ Sbjct 1699 PRVFPSLYKLAPEFGSREETLEETHSLALELRGRTPERMNERLGLASYTFAKKYAKKARL 1758 Query 73 LTISRMK 79 +T+SR++ Sbjct 1759 MTLSRLR 1765 > dre:100150181 tmtc3; transmembrane and tetratricopeptide repeat containing 3 Length=906 Score = 32.0 bits (71), Expect = 0.46, Method: Composition-based stats. Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 11/78 (14%) Query 15 CFPRITRMFPEFGMREEDLSEKASLALGLRGRSPSRMNDRCMISTLAVA--KKYARRAKV 72 CF RI M P ++ K +L + + +RC++ TLA+A ++Y RR Sbjct 759 CFERILSMDPS------NVQAKHNLCVVYFEERELQRAERCLVDTLAMAPQEEYIRRHLA 812 Query 73 LTISRMKARRGASRAGQP 90 + ++M A S AGQP Sbjct 813 IVRNKMAA---MSAAGQP 827 > ath:AT4G20860 FAD-binding domain-containing protein Length=530 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 0/32 (0%) Query 4 FVGLLFARIPQCFPRITRMFPEFGMREEDLSE 35 F L I + P + + FPE G+R +D SE Sbjct 307 FQTLFLGGIDRLIPLMNQKFPELGLRSQDCSE 338 > pfa:MAL13P1.19 peptidase, putative Length=9271 Score = 28.5 bits (62), Expect = 4.8, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query 18 RITRMFPEFGMREEDLSEKASLALGLRGRSPSRMNDRCMISTLAVAKKYARRA 70 +IT MFPE+ ++++ +EK ++L + +S +N R S+ ++ K R+ Sbjct 3662 KITDMFPEYKNKKDNHNEK--MSLNILAQSYPVVNKRKYKSSTSLNNKRGRKG 3712 > cpv:cgd5_3370 hypothetical protein Length=1019 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Query 28 MREEDLSEKASLALGLRGRSPSRMNDRCMIS--TLAVAKKY 66 + +EDLS+K + L R +++ND+C+I+ TL ++ Y Sbjct 634 IHKEDLSQKICIYQSLLQRIINKLNDKCLINKETLPLSSLY 674 Lambda K H 0.326 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2012750684 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40