bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_3154_orf2 Length=51 Score E Sequences producing significant alignments: (Bits) Value At3g13640 83.2 1e-16 At4g19210 79.7 1e-15 Hs20532766 77.8 4e-15 CE21713 74.7 4e-14 Hs4506559 74.7 4e-14 7295014 74.3 5e-14 YDR091c 73.6 9e-14 SPBC14F5.06 65.5 2e-11 ECU11g1580 56.6 1e-08 > At3g13640 Length=603 Score = 83.2 bits (204), Expect = 1e-16, Method: Composition-based stats. Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 SL++GMN FL LNITFRRDPTNFRPRINKL+S KDKEQK G+++ LDD Sbjct 554 SLLSGMNHFLSHLNITFRRDPTNFRPRINKLESIKDKEQKTAGSYYYLDD 603 > At4g19210 Length=600 Score = 79.7 bits (195), Expect = 1e-15, Method: Composition-based stats. Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 SL++GMN FL LNITFRRDPTNFRPRINKL+S KD+EQK G+++ LDD Sbjct 551 SLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 600 > Hs20532766 Length=599 Score = 77.8 bits (190), Expect = 4e-15, Method: Composition-based stats. Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP N+RPRINKL+S KD EQK +GN+F LDD Sbjct 550 TLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > CE21713 Length=610 Score = 74.7 bits (182), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 0/51 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDDN 51 SL+ GMN+FLK+L+ITFRRD +RPRINKLDS KD +QK +G FF LDDN Sbjct 560 SLLEGMNRFLKMLDITFRRDQETYRPRINKLDSVKDVDQKKSGQFFFLDDN 610 > Hs4506559 Length=599 Score = 74.7 bits (182), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 +L+ GMNKFL L ITFRRDP N+RPRINKL+S KD EQK +GN+F LDD Sbjct 550 TLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD 599 > 7295014 Length=611 Score = 74.3 bits (181), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 0/51 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDDN 51 SL+NGMN+FL++L ITFRRDP NFRPRINK +S KD EQK +G FF L+D Sbjct 558 SLLNGMNRFLELLGITFRRDPNNFRPRINKNNSVKDTEQKRSGQFFFLEDE 608 > YDR091c Length=608 Score = 73.6 bits (179), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 0/51 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDDN 51 SL+ G N+FLK LN+TFRRDP +FRPRINKLDS DKEQK +GN+F LD+ Sbjct 556 SLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNYFFLDNT 606 > SPBC14F5.06 Length=593 Score = 65.5 bits (158), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFFVLDD 50 SL+ GMN FLK L++TFRRDP RPRINK DS D+EQK GN+F L++ Sbjct 544 SLLTGMNTFLKNLDVTFRRDPNTLRPRINKFDSQMDQEQKNAGNYFFLEN 593 > ECU11g1580 Length=624 Score = 56.6 bits (135), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 26/46 (56%), Positives = 34/46 (73%), Gaps = 0/46 (0%) Query 1 SLINGMNKFLKVLNITFRRDPTNFRPRINKLDSCKDKEQKLNGNFF 46 L++GMN FLK L++TFRRD +N RPR+NK S KD+ QK N +F Sbjct 577 GLLDGMNIFLKSLDVTFRRDSSNLRPRVNKPGSAKDRIQKENNQYF 622 Lambda K H 0.323 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161614636 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40