bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_3032_orf2 Length=52 Score E Sequences producing significant alignments: (Bits) Value 7302938 51.2 4e-07 Hs4504429 48.5 3e-06 YML126c 46.2 1e-05 SPAC4F8.14c 42.0 3e-04 Hs5031751 40.0 0.001 Hs17449881 36.6 0.012 At4g11820 35.0 0.037 ECU10g0660 26.9 9.1 > 7302938 Length=465 Score = 51.2 bits (121), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 0/51 (0%) Query 1 VPAEQFEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAYNK 51 V EQF + +RE + APY P G IS L GTYYL DV H R Y + Sbjct 406 VAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYER 456 > Hs4504429 Length=520 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 0/51 (0%) Query 1 VPAEQFEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAYNK 51 V + F E + LRE+TH L Y P G I L GT+YL V KH R Y + Sbjct 418 VAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYAR 468 > YML126c Length=491 Score = 46.2 bits (108), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 0/47 (0%) Query 4 EQFEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAYN 50 + +E + LREN H +KP G I L SG YYLT++ K R+Y+ Sbjct 442 KDYEAAIELRENAHLKKNFKPQGSIEHLQSGVYYLTNIDDKFRRSYD 488 > SPAC4F8.14c Length=447 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 0/46 (0%) Query 5 QFEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAYN 50 Q+EE + LR H + P G I L SGTYYLT + R+Y+ Sbjct 399 QYEEAIELRHQAHLKKNFTPKGSIERLRSGTYYLTGIDDMFRRSYS 444 > Hs5031751 Length=508 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 0/51 (0%) Query 1 VPAEQFEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAYNK 51 V E+F E +N RE + + P GD + L GT+YL V +H R Y + Sbjct 455 VSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYAR 505 > Hs17449881 Length=477 Score = 36.6 bits (83), Expect = 0.012, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 6 FEETLNLRENTHSLAPYKPAGDISLLSSGTYYLTDVSTKHHRAY 49 F E + LRE+TH L P G L T+YL V KH R+Y Sbjct 380 FVENMKLREDTHHLVNSVPRGPRDSLFEETWYLAMVGEKHRRSY 423 > At4g11820 Length=461 Score = 35.0 bits (79), Expect = 0.037, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query 4 EQFEETLNLRENTHSLAPY--KPAGDISLLSSGTYYLTDVSTKHHRAYNK 51 E+F ET+ L E+ + + G I LL+ GTYYL +V + + R Y K Sbjct 401 EKFVETMKLMEHRYGAKDFVTTKEGIIDLLAPGTYYLKEVDSLYRRFYGK 450 > ECU10g0660 Length=377 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Query 6 FEETLNLRENTHSLAPYKPAGDISLLSSGTYYL---TDVSTKHHRA 48 F L+ REN S P KP D+ LLS Y++ + +KH +A Sbjct 272 FSYLLSRRENVVS-GPEKPLSDLGLLSYRAYWMEVIVEYLSKHDKA 316 Lambda K H 0.311 0.127 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40