bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2836_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value At1g62740 51.2 4e-07 At4g12400 48.1 4e-06 At1g12270 45.8 2e-05 7296220 35.8 0.019 Hs5803181 30.0 1.1 Hs5730041_1 29.3 2.0 SPAPB2B4.01c 28.5 3.1 At4g11260_1 28.5 3.3 At4g37460 28.1 4.0 Hs14729151 28.1 4.5 CE29643 28.1 4.7 7303946 27.7 5.1 Hs18677737 27.7 6.2 Hs17149851 26.9 8.5 > At1g62740 Length=571 Score = 51.2 bits (121), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 38/56 (67%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRKG++ F +KEY A+E + KGL DPN++E +DG + V+++ + G++ E+ Sbjct 454 SRKGAVQFFMKEYDNAMETYQKGLEHDPNNQELLDGVKRCVQQINKANRGDLTPEE 509 Score = 34.7 bits (78), Expect = 0.041, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 SR G+ H L ++ +A+EA+ KGL IDP+++ G Sbjct 74 SRLGAAHLGLNQFDEAVEAYSKGLEIDPSNEGLKSG 109 > At4g12400 Length=558 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 37/56 (66%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRKG++ F +KEY KA+E + +GL DP ++E +DG + V ++ + G++ E+ Sbjct 441 SRKGAIQFFMKEYDKAMETYQEGLKHDPKNQEFLDGVRRCVEQINKASRGDLTPEE 496 Score = 27.3 bits (59), Expect = 6.9, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 SR G+ L ++ +A++++ KGL IDP+++ G Sbjct 74 SRLGAAFIGLSKFDEAVDSYKKGLEIDPSNEMLKSG 109 > At1g12270 Length=572 Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRK ++ F LKEY A+E + GL DP+++E +DG + V+++ + G++ E+ Sbjct 455 SRKAAVQFFLKEYDNAMETYQAGLEHDPSNQELLDGVKRCVQQINKANRGDLTPEE 510 Score = 31.2 bits (69), Expect = 0.54, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 SR G+ H L ++ A+ A+ KGL +DP ++ G Sbjct 74 SRLGAAHLGLNQFELAVTAYKKGLDVDPTNEALKSG 109 > 7296220 Length=490 Score = 35.8 bits (81), Expect = 0.019, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 0/41 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVV 41 SRKG+ L ++ KA EA+++GL DP + + G+M+ Sbjct 76 SRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQGRMETT 116 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 0/45 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQ 46 RKG + +++ +KA A+ K L +DPN+ E ++G Q Q+ Sbjct 383 RKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMNFQR 427 > Hs5803181 Length=543 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RK + +K+Y KA++ + K L +D + KE DG Sbjct 432 TRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADG 467 > Hs5730041_1 Length=137 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 6/50 (12%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQV-VRKVQQQQSG 50 RKG + K YA ALE F +G +D D V +++ Q+ Q+G Sbjct 84 RKGICEYHEKNYAAALETFTEGQKLDS-----ADANFSVWIKRCQEAQNG 128 > SPAPB2B4.01c Length=248 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query 15 KALEAFD-KGLAIDPNSKECMDGKMQVVRKVQQQQ 48 K L FD KG++ PN C +G M++V+ Q Q Sbjct 133 KTLITFDNKGISGHPNHIACYEGAMKIVKATPQVQ 167 > At4g11260_1 Length=160 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPN 29 RKG+ +L+EY+ A A +KG ++ PN Sbjct 75 RKGTACMKLEEYSTAKAALEKGASVAPN 102 > At4g37460 Length=1013 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECM 34 R+G L EY +A+E K L +PNS + + Sbjct 370 RRGQARAALGEYVEAVEDLTKALVFEPNSPDVL 402 > Hs14729151 Length=387 Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Query 3 KGSL-HFQLKEYAKALEAFDKGLAIDPNSKEC--MDGKMQVVRKVQQQ 47 +G+L H +LK +A+A+ D+GL ID K+ M K +++++Q+ Sbjct 156 RGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQR 203 > CE29643 Length=603 Score = 28.1 bits (61), Expect = 4.7, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 4 GSLHFQLKEYAKALEAFDKGL-AIDPNSKE 32 G+L F+ K+Y ALEAF KG+ PNS + Sbjct 51 GNLKFKEKQYDSALEAFTKGVEKAGPNSSD 80 > 7303946 Length=1119 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 0/32 (0%) Query 4 GSLHFQLKEYAKALEAFDKGLAIDPNSKECMD 35 G LH LK Y+ AL K + P+ EC D Sbjct 413 GKLHMALKNYSDALNYVLKATRLRPHFAECFD 444 > Hs18677737 Length=420 Score = 27.7 bits (60), Expect = 6.2, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSK 31 R+G+ QL+ Y + L+ ++ L IDP++K Sbjct 371 RRGTAFCQLELYVEGLQDYEAALKIDPSNK 400 > Hs17149851 Length=356 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 0/50 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGE 51 RKG + Q EY++A+ L ++P++K ++V+K Q+S E Sbjct 255 RKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTE 304 Lambda K H 0.311 0.128 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40