bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2668_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value At1g62290 57.0 1e-08 At1g11910 55.8 2e-08 CE03567 52.0 3e-07 At4g04460 51.6 4e-07 Hs4503143 51.6 4e-07 Hs4503145 51.2 6e-07 7290034 51.2 6e-07 Hs22063919 50.4 1e-06 Hs4758754 50.1 1e-06 Hs4506475 49.7 2e-06 7297766 48.1 5e-06 7303185 47.8 6e-06 Hs4505757 47.8 6e-06 7304149 47.0 1e-05 CE19495 46.6 2e-05 Hs22050827 46.2 2e-05 7297427 43.9 1e-04 YPL154c 43.5 1e-04 CE21683 42.4 3e-04 CE09540 42.0 4e-04 CE04971 41.6 5e-04 At3g12700 41.6 5e-04 CE09542 41.2 5e-04 7296076 41.2 6e-04 At4g22050 40.8 7e-04 CE09539 40.4 0.001 CE09738 40.0 0.001 7300255 40.0 0.001 At1g69100 39.7 0.002 CE05287 37.0 0.012 CE21681 37.0 0.012 7300253 36.6 0.015 7300254 36.6 0.015 CE21685 36.6 0.016 CE25019 35.4 0.034 CE16843 34.3 0.068 CE11480 34.3 0.074 At3g51340 33.9 0.084 7296077 33.5 0.12 CE09541 32.3 0.24 7297765 32.0 0.35 YDR144c 32.0 0.37 At4g35880 32.0 0.38 YIL015w 31.6 0.43 At1g08210 30.8 0.78 At3g02740 30.8 0.84 Hs21040360 30.4 1.0 Hs19923395 30.4 1.0 CE11478 30.0 1.3 7296075 30.0 1.3 > At1g62290 Length=526 Score = 57.0 bits (136), Expect = 1e-08, Method: Composition-based stats. Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Query 68 KLDNRYKFTGLGELVSQLIDHHTTMGSVGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRF 127 +L R+ L S L ++ +G G SG L NY ++QY+GEI IGTP ++F Sbjct 45 RLATRFGSKQEEALRSSLRSYNNNLG--GDSGDADIVPLKNYLDAQYYGEIAIGTPPQKF 102 Query 128 VVVFDTGSSNL 138 V+FDTGSSNL Sbjct 103 TVIFDTGSSNL 113 > At1g11910 Length=506 Score = 55.8 bits (133), Expect = 2e-08, Method: Composition-based stats. Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 0/44 (0%) Query 95 VGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 +G SG L NY ++QY+GEI IGTP ++F VVFDTGSSNL Sbjct 63 LGDSGDADVVVLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNL 106 > CE03567 Length=444 Score = 52.0 bits (123), Expect = 3e-07, Method: Composition-based stats. Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY ++QYFG I IGTP + F V+FDTGSSNL Sbjct 86 LRNYMDAQYFGTISIGTPAQNFTVIFDTGSSNL 118 > At4g04460 Length=508 Score = 51.6 bits (122), Expect = 4e-07, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 28/33 (84%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY ++QY+G+I IGTP ++F V+FDTGSSNL Sbjct 79 LKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNL 111 > Hs4503143 Length=412 Score = 51.6 bits (122), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY ++QY+GEI IGTP + F VVFDTGSSNL Sbjct 71 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNL 103 > Hs4503145 Length=396 Score = 51.2 bits (121), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 0/37 (0%) Query 102 ARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 A++ L+NY + +YFG I IG+P + F V+FDTGSSNL Sbjct 66 AKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNL 102 > 7290034 Length=407 Score = 51.2 bits (121), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 23/35 (65%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + L NY N QY+G I IGTPG+ F+V FDTGSSNL Sbjct 67 EHLSNYDNFQYYGNISIGTPGQDFLVQFDTGSSNL 101 > Hs22063919 Length=267 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/36 (63%), Positives = 26/36 (72%), Gaps = 0/36 (0%) Query 103 RQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q L NY + +YFG I IGTP + F VVFDTGSSNL Sbjct 65 EQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNL 100 > Hs4758754 Length=420 Score = 50.1 bits (118), Expect = 1e-06, Method: Composition-based stats. Identities = 22/33 (66%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY + QYFGEI +GTP + F V FDTGSSNL Sbjct 70 LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNL 102 > Hs4506475 Length=406 Score = 49.7 bits (117), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY ++QY+GEI IGTP + F VVFDTGSSN+ Sbjct 78 LTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNV 110 > 7297766 Length=391 Score = 48.1 bits (113), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Query 94 SVGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 SV SSG A + L N N++Y+G I IGTP +RF ++FDTGS+NL Sbjct 58 SVSSSG--ATENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANL 100 > 7303185 Length=404 Score = 47.8 bits (112), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY ++QYFG I IGTP + F V+FDTGSSNL Sbjct 77 LSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNL 109 > Hs4505757 Length=388 Score = 47.8 bits (112), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 20/32 (62%), Positives = 26/32 (81%), Gaps = 0/32 (0%) Query 107 LNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + Y ++ YFGEI IGTP + F+V+FDTGSSNL Sbjct 66 MAYMDAAYFGEISIGTPPQNFLVLFDTGSSNL 97 > 7304149 Length=392 Score = 47.0 bits (110), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + L NY ++QY+G I IG+P + F VVFDTGSSNL Sbjct 63 EPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNL 97 > CE19495 Length=398 Score = 46.6 bits (109), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + L +Y N+QY+G + IGTP + F V+FDTGSSNL Sbjct 59 EGLSDYSNAQYYGPVTIGTPPQNFQVLFDTGSSNL 93 > Hs22050827 Length=160 Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 0/37 (0%) Query 102 ARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 A L + ++QYFGEI +GTP + F V FDTGSSNL Sbjct 66 ASVPLSKFLDAQYFGEIGLGTPPQNFTVAFDTGSSNL 102 > 7297427 Length=372 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 0/36 (0%) Query 103 RQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 ++L N N Y+G I IGTP + F V+FD+GSSNL Sbjct 58 EEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNL 93 > YPL154c Length=405 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NY N+QY+ +I +GTP + F V+ DTGSSNL Sbjct 83 LTNYLNAQYYTDITLGTPPQNFKVILDTGSSNL 115 > CE21683 Length=320 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q ++Y + Y G I +GTPG+ +V DTGSSNL Sbjct 59 QPFIDYMDDFYLGNISVGTPGQTLTLVLDTGSSNL 93 > CE09540 Length=395 Score = 42.0 bits (97), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 27/37 (72%), Gaps = 0/37 (0%) Query 102 ARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 A Q + ++ + +Y G I IGTP ++F+VV DTGS+NL Sbjct 61 APQNVNDFGDVEYLGNITIGTPPQQFIVVLDTGSANL 97 > CE04971 Length=709 Score = 41.6 bits (96), Expect = 5e-04, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q + +Y + Y G I IGTP ++F V+ DTGSSNL Sbjct 344 QYVNDYEDEAYVGNITIGTPQQQFKVILDTGSSNL 378 Score = 37.4 bits (85), Expect = 0.010, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 108 NYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 +Y ++ Y G+I +G+P + F V+ DTGSSN Sbjct 34 DYEHAGYVGKITVGSPPQEFRVIMDTGSSNF 64 > At3g12700 Length=439 Score = 41.6 bits (96), Expect = 5e-04, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%) Query 107 LNYHNSQYFGEIKIGTPGRRFVVVFDTGS 135 ++Y +QYF EI++GTP ++F VV DTGS Sbjct 77 IDYGTAQYFTEIRVGTPAKKFRVVVDTGS 105 > CE09542 Length=389 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q + ++ + +Y G I IGTP + F+VV DTGSSNL Sbjct 61 QNVNDFGDFEYLGNITIGTPDQGFIVVLDTGSSNL 95 > 7296076 Length=405 Score = 41.2 bits (95), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 ++L N N Y+G I IGTP + F VVFDTGS+NL Sbjct 83 EELGNSMNMYYYGLIGIGTPEQYFKVVFDTGSANL 117 > At4g22050 Length=336 Score = 40.8 bits (94), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 26/34 (76%), Gaps = 0/34 (0%) Query 105 KLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 +L N + Y+G+I+IG PG+ F V+FDTGSS+L Sbjct 37 QLKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSL 70 > CE09539 Length=393 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%) Query 102 ARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 A Q + ++ + +Y G I IGTP + F+VV DTGSSNL Sbjct 61 APQNVNDFGDFEYLGNITIGTPPQPFLVVLDTGSSNL 97 > CE09738 Length=389 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q +Y +Y G I +GTP + F+VV DTGS+NL Sbjct 62 QSTTDYVYYEYMGNITVGTPDQNFIVVLDTGSANL 96 > 7300255 Length=395 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Query 83 SQLIDHHTTMGS--VGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 S L+ + +G V S A + L N N +Y G I IG+PG+ F ++FDTGS+NL Sbjct 48 SSLLAKYNVVGGQEVTSRNGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANL 105 > At1g69100 Length=343 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 25/33 (75%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L N+ ++GEI +G+P ++F VVFDTGS++L Sbjct 39 LKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDL 71 > CE05287 Length=428 Score = 37.0 bits (84), Expect = 0.012, Method: Composition-based stats. Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 7/88 (7%) Query 52 TADLHT-NLLREPPMTIKLDNRYKFTGLGELVSQLIDHHTTMGSVGSSGTMARQKLLNYH 110 +A++H N+ P M +++ + K + ++L+ + + SS +++Y Sbjct 15 SAEVHQFNIGYRPNMRQRMNAKGKLAEYEKERNELLSKKSLQLASSSS------PVIDYE 68 Query 111 NSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + Y +I +G+P + FV+ D+GSSNL Sbjct 69 DMAYMVQISLGSPAQNFVLFIDSGSSNL 96 > CE21681 Length=396 Score = 37.0 bits (84), Expect = 0.012, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q ++Y + Y G I +GTP + VV DTGSSNL Sbjct 58 QPFVDYFDDFYLGNITLGTPPQPATVVLDTGSSNL 92 > 7300253 Length=465 Score = 36.6 bits (83), Expect = 0.015, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Query 97 SSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 SSGT L N N +Y ++ IGTP ++F V+ DTGSSN+ Sbjct 136 SSGTAT---LKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNI 174 > 7300254 Length=309 Score = 36.6 bits (83), Expect = 0.015, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 113 QYFGEIKIGTPGRRFVVVFDTGSSN 137 +Y+G I +G P + F V+FDTGSSN Sbjct 2 EYYGTIAMGNPRQNFTVIFDTGSSN 26 > CE21685 Length=829 Score = 36.6 bits (83), Expect = 0.016, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q L++Y++ Y I +GTP + VV DT S+NL Sbjct 58 QPLIDYYDDMYLANITVGTPPQPASVVLDTASANL 92 Score = 33.5 bits (75), Expect = 0.14, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 Q + +Y + Y G +GTP + +V DTGS+N+ Sbjct 493 QPISDYSDEVYLGNFTVGTPPQPVSLVLDTGSANM 527 > CE25019 Length=391 Score = 35.4 bits (80), Expect = 0.034, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 45/96 (46%), Gaps = 21/96 (21%) Query 34 RHRFLSETLEEPEDVML---KTADLHTNLLREPPM----TIKLDNRYKFT-----GLGEL 81 R +FLSE LE PE++ML K ADL + PP+ T++L FT G+G++ Sbjct 28 RQKFLSENLENPEEIMLNGIKLADLKIGPVDMPPLDHRQTVQLS---MFTVKTRRGIGQI 84 Query 82 VSQLIDHHTTMGSVGSSGTMARQKLLNYHNSQYFGE 117 + +L G S + R +LN GE Sbjct 85 LFEL------AALFGISRKLGRVPVLNRLQEPLIGE 114 > CE16843 Length=394 Score = 34.3 bits (77), Expect = 0.068, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 5/41 (12%) Query 103 RQKLLNYHNSQYFGEIKIGTP-----GRRFVVVFDTGSSNL 138 Q + ++ + YFG I +GTP + F+VV DTGSSN+ Sbjct 55 HQHVADFRDFAYFGNITLGTPIESTAEQTFLVVLDTGSSNV 95 > CE11480 Length=474 Score = 34.3 bits (77), Expect = 0.074, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 ++ + Y ++IGTP + F V FDT SSNL Sbjct 145 FFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNL 177 > At3g51340 Length=518 Score = 33.9 bits (76), Expect = 0.084, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Query 87 DHHTTMGSVGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGS 135 + T + S+GS+ T+A LN+ ++ + +GTP F+V DTGS Sbjct 68 NEETPLTSIGSNLTLA----LNFLGFLHYANVSLGTPATWFLVALDTGS 112 > 7296077 Length=418 Score = 33.5 bits (75), Expect = 0.12, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Query 100 TMARQKLLNYHNSQYFGEIKIGTPGRRFVVVF-DTGSSNL 138 T++++ L+N HN++Y+ GTP + V + DT S+NL Sbjct 78 TVSKENLINSHNTEYYVTAGFGTPKSQPVTLLVDTASANL 117 > CE09541 Length=350 Score = 32.3 bits (72), Expect = 0.24, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 104 QKLLNYHNSQYFGEIKIGTPGRRFVVVFDT 133 Q + ++ + +Y G I IGTP + F+VV DT Sbjct 62 QNVNDFADFEYLGNITIGTPDQSFIVVLDT 91 > 7297765 Length=423 Score = 32.0 bits (71), Expect = 0.35, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 95 VGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 V + Q L N N +Y + IGTP + F + FDTGSS+L Sbjct 55 VDRQSSQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDL 98 > YDR144c Length=596 Score = 32.0 bits (71), Expect = 0.37, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 107 LNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L NS Y E+ IGTP ++ V+ DTGSS+L Sbjct 74 LTNQNSFYSVELDIGTPPQKVTVLVDTGSSDL 105 > At4g35880 Length=455 Score = 32.0 bits (71), Expect = 0.38, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 114 YFGEIKIGTPGRRFVVVFDTGS 135 ++ +K+GTPG RF+V DTGS Sbjct 107 HYTTVKLGTPGMRFMVALDTGS 128 > YIL015w Length=587 Score = 31.6 bits (70), Expect = 0.43, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query 91 TMGSVGSSGTMARQKLLNYHNSQYFGE-IKIGTPGRRFVVVFDTGSSNL 138 T+ ++ + GT + LL + Y+ + IGTP + V+FDTGS++ Sbjct 21 TITALTNDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADF 69 > At1g08210 Length=566 Score = 30.8 bits (68), Expect = 0.78, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 114 YFGEIKIGTPGRRFVVVFDTGSSNL 138 Y+ ++K+GTP R F V DTGS L Sbjct 132 YYTKVKLGTPPREFNVQIDTGSDVL 156 > At3g02740 Length=488 Score = 30.8 bits (68), Expect = 0.84, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 114 YFGEIKIGTPGRRFVVVFDTGSSNL 138 YF +I +GTP R F V DTGS L Sbjct 85 YFAKIGLGTPSRDFHVQVDTGSDIL 109 > Hs21040360 Length=468 Score = 30.4 bits (67), Expect = 1.0, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 114 YFGEIKIGTPGRRFVVVFDTGSSNL 138 Y+ E+ IGTP ++ ++ DTGSSN Sbjct 92 YYLEMLIGTPPQKLQILVDTGSSNF 116 > Hs19923395 Length=518 Score = 30.4 bits (67), Expect = 1.0, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 114 YFGEIKIGTPGRRFVVVFDTGSSNL 138 Y+ E+ IGTP ++ ++ DTGSSN Sbjct 92 YYLEMLIGTPPQKLQILVDTGSSNF 116 > CE11478 Length=383 Score = 30.0 bits (66), Expect = 1.3, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 100 TMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 + + + ++ + Y ++IGTP + F V DT SSNL Sbjct 48 STGNESIYDHFDEYYTVSVRIGTPAQHFEVALDTTSSNL 86 > 7296075 Length=410 Score = 30.0 bits (66), Expect = 1.3, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 106 LLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNL 138 L N +N++Y+ + G P + V+ DTGS+NL Sbjct 82 LENLYNTEYYTTLGFGNPPQDLKVLIDTGSANL 114 Lambda K H 0.317 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1498437086 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40