bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2508_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value At5g20570 31.6 0.38 7290070 28.5 3.1 Hs7657508 28.5 3.3 At3g42830 28.5 3.4 CE20174 27.7 5.1 > At5g20570 Length=120 Score = 31.6 bits (70), Expect = 0.38, Method: Compositional matrix adjust. Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query 1 YLKLKNMHSLLQLDFSELKELHQQTVDKLVECRTRLRDLKMQCALNQASA 50 + L+N ++L + S + + VD CR + DL ++C NQASA Sbjct 45 WGNLENPYTLSSIGLSMFRYI---VVDNCAICRNHIMDLCIECQANQASA 91 > 7290070 Length=108 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 25 TVDKLVECRTRLRDLKMQCALNQASA 50 VD CR + DL ++C NQASA Sbjct 38 VVDNCAICRNHIMDLCIECQANQASA 63 > Hs7657508 Length=108 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 25 TVDKLVECRTRLRDLKMQCALNQASA 50 VD CR + DL ++C NQASA Sbjct 38 VVDNCAICRNHIMDLCIECQANQASA 63 > At3g42830 Length=115 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 25 TVDKLVECRTRLRDLKMQCALNQASA 50 VD CR + DL ++C NQASA Sbjct 45 VVDNCAICRNHIMDLCIECLANQASA 70 > CE20174 Length=403 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query 6 NMHSLL-QLDFSELKELHQQTVDKLVECRTRLRDLKMQCALNQASADWRFF 55 N +SL+ +L+ + E+ +T D + E R + R + C N++S+ +R++ Sbjct 217 NNNSLMCRLNIEFICEIADETADHVQEARRQNRGFECPCFCNRSSSHFRYY 267 Lambda K H 0.317 0.130 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40