bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2012_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value Hs4507783 38.1 0.004 CE25632 37.7 0.005 SPBC211.07c 35.8 0.018 At2g46030 35.4 0.029 7290876 35.0 0.034 YEL012w 33.1 0.12 ECU08g0860 33.1 0.14 At1g63800 32.7 0.17 At5g41340 32.3 0.23 At1g60390 29.3 1.9 Hs6005762 28.9 2.2 Hs4758072 28.5 3.6 Hs17472965 28.1 4.3 Hs22042707 27.7 5.6 > Hs4507783 Length=183 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGF+NKI HPN+DEASG Sbjct 59 DKYPFKSPSIGFMNKIFHPNIDEASG 84 > CE25632 Length=241 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D+ K IGFLNKI HPN+DEASG Sbjct 83 DKYPFKSPSIGFLNKIFHPNIDEASG 108 > SPBC211.07c Length=184 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Query 53 ISSSRK--QCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 +SS R+ + D KLLM+ Y++ L N N Q+F V FHG Sbjct 1 MSSPRRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHG 38 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 6 KRIIIGFLNKILHPNVDEASG 26 K IGF+N+I HPN+DE SG Sbjct 62 KSPSIGFVNRIFHPNIDELSG 82 > At2g46030 Length=183 Score = 35.4 bits (80), Expect = 0.029, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 6 KRIIIGFLNKILHPNVDEASG 26 K +GF+NKI HPNVDE+SG Sbjct 62 KSPSVGFVNKIYHPNVDESSG 82 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 55 SSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 S R++ D KL+M+ Y ++ N + Q F V FHG Sbjct 5 SKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHG 38 > 7290876 Length=183 Score = 35.0 bits (79), Expect = 0.034, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 6 KRIIIGFLNKILHPNVDEASG 26 K IGF+NKI HPN+DE+SG Sbjct 64 KSPSIGFVNKIYHPNIDESSG 84 > YEL012w Length=218 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D K IGF+NKI HPN+D ASG Sbjct 57 DNYPYKSPSIGFVNKIFHPNIDIASG 82 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Query 53 ISSSRK--QCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 +SSS++ + D KLLM+ + ++L N + Q+F+V F G Sbjct 1 MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLG 38 > ECU08g0860 Length=171 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 0/19 (0%) Query 10 IGFLNKILHPNVDEASGHF 28 IGF +I HPNVDEASG Sbjct 66 IGFTTRIFHPNVDEASGSI 84 > At1g63800 Length=170 Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D K +GF+ KI HPNVDE SG Sbjct 42 DAYPYKSPSVGFITKIYHPNVDEMSG 67 > At5g41340 Length=187 Score = 32.3 bits (72), Expect = 0.23, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 DRRRRKRIIIGFLNKILHPNVDEASG 26 D K +GF+ KI HPNVDE SG Sbjct 57 DAYPYKSPSVGFITKIYHPNVDELSG 82 Score = 32.3 bits (72), Expect = 0.25, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 55 SSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHG 88 S R++ D KL+M+ Y +E N Q+F V F+G Sbjct 5 SKRREMDMMKLMMSDYKVETINDGMQEFYVEFNG 38 > At1g60390 Length=624 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 5 RKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWC 39 +K+++IG +N I +V A Q L PYL ++C Sbjct 520 KKKVVIGKVNGINGGDVTRAVSCHQSLYPYLLYYC 554 > Hs6005762 Length=581 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 10/62 (16%) Query 14 NKILHPNVDEASGHFQGLPPYLRFWC------FLCQIYLKMTQVQISSS----RKQCDFA 63 N + H N EA+ P + + C FLC +Y M Q+S+ R C+ A Sbjct 54 NLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQA 113 Query 64 KL 65 +L Sbjct 114 RL 115 > Hs4758072 Length=586 Score = 28.5 bits (62), Expect = 3.6, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Query 4 RRKRIIIGFLNKILHPNVDEASGHFQGLPPYLRFWCFLCQI-YLKMT----QVQISSSRK 58 RK + F ++ N AS GL PYLRF C C++ Y K+T +V+ +SS Sbjct 226 ERKAWVANFERPRMNANSLLASP--TGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPP 283 Query 59 QCDFAKLL 66 + +LL Sbjct 284 LSLYGQLL 291 > Hs17472965 Length=593 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 0/16 (0%) Query 30 GLPPYLRFWCFLCQIY 45 GL PYLRF C C+++ Sbjct 269 GLSPYLRFGCLSCRLF 284 > Hs22042707 Length=559 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query 30 GLPPYLRFWCFLC----QIYLKMTQVQISSSRKQCDFAKLLMAG 69 G+ L CF+C IY+ T ++I +++ CD+ K L AG Sbjct 199 GVGACLSISCFICIVISYIYIFSTVLKIPTTKGLCDWVKGLSAG 242 Lambda K H 0.329 0.144 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184307974 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40