bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1885_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value Hs5031677 33.1 0.14 Hs6996005 32.7 0.17 Hs6996007 32.7 0.17 7293152 32.0 0.27 Hs22042377 32.0 0.32 At2g14120 30.8 0.56 CE29474 29.6 1.5 At5g44180 28.5 3.3 > Hs5031677 Length=699 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 68 IRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 I R + +YF +V N++D+VPK + FLV ++D Sbjct 610 IERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKD 643 > Hs6996005 Length=736 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 68 IRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 I R + +YF +V N++D+VPK + FLV ++D Sbjct 647 IERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKD 680 > Hs6996007 Length=710 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 68 IRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 I R + +YF +V N++D+VPK + FLV ++D Sbjct 621 IERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKD 654 > 7293152 Length=819 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 62 EQFIQEIRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 E+ ++ IR +D+Y +V RD VPK I ++ +D Sbjct 651 ERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKD 690 > Hs22042377 Length=863 Score = 32.0 bits (71), Expect = 0.32, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 0/40 (0%) Query 62 EQFIQEIRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 E+ ++ IR +D+Y ++ +RD +PK I ++ ++D Sbjct 650 ERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKD 689 > At2g14120 Length=782 Score = 30.8 bits (68), Expect = 0.56, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Query 40 QQVQNQMSTLWASKD----KKKPVYSEQFIQEI---RRRLDAYFGLVLHNVRDTVPKKIG 92 Q+V +ST++ + K +SEQ EI + L +Y+ +V NV D VPK I Sbjct 624 QEVYQNLSTIYLKEPPTILKSSETHSEQESVEIEITKLLLKSYYDIVRKNVEDLVPKAIM 683 Query 93 FFLV 96 FLV Sbjct 684 HFLV 687 > CE29474 Length=700 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 68 IRRRLDAYFGLVLHNVRDTVPKKIGFFLVRQLQD 101 I R + YF +V N++D+VPK I LV ++D Sbjct 616 IERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRD 649 > At5g44180 Length=1694 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 0/49 (0%) Query 20 GPDGRPLQQPSHAERAQQMLQQVQNQMSTLWASKDKKKPVYSEQFIQEI 68 G G P++ PSH + +Q + S + KD +P+ QFI E+ Sbjct 169 GAFGMPIEMPSHRKATRQAFETNIYVRSDVKPIKDHVRPIREYQFIPEL 217 Lambda K H 0.320 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184494980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40