bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1682_orf1 Length=53 Score E Sequences producing significant alignments: (Bits) Value Hs4506229 47.4 7e-06 CE00101 45.4 3e-05 7298530 44.7 4e-05 YER021w 42.4 2e-04 At1g75990 40.4 7e-04 At1g20200 38.5 0.003 ECU05g1540 30.0 1.1 Hs20541815 28.9 2.7 At2g19560 28.5 3.0 > Hs4506229 Length=534 Score = 47.4 bits (111), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 0/46 (0%) Query 8 VRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 VR+G+L F VL Q +F+ D T+TL+ RL NVI+ G+R+ISL Sbjct 367 VRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISL 412 > CE00101 Length=504 Score = 45.4 bits (106), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y ++ VR GD+ F L+Q + +F+ DDT TL+ RL QNVI+ ++ ISL Sbjct 328 YLDLSRGVRDGDVARFNHNLEQFKTQFEADDTLTLIVRLRQNVIKTAIKQISL 380 > 7298530 Length=494 Score = 44.7 bits (104), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y ++ VR G+L F V+ Q+ +F+LD TFTL+ RL NVI+ +R I L Sbjct 321 YFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLRHNVIKTAIRSIGL 373 > YER021w Length=523 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y + V+ GDL F + + +++ DDT+ L RL NVI+ G+RIISL Sbjct 345 YYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISL 397 > At1g75990 Length=487 Score = 40.4 bits (93), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y E+ VR GDL F + ++ F D T L+ RL NVIR GLR IS+ Sbjct 312 YFELTNAVRIGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISI 364 > At1g20200 Length=488 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y E+ VR GDL F V ++ F D T L+ RL NVIR GLR IS+ Sbjct 313 YFELTNAVRIGDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISI 365 > ECU05g1540 Length=376 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 0/53 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNVIRAGLRIISL 53 Y ++ V+ D+ F L+ ++ + + +RL QNVI+ G+R IS+ Sbjct 232 YFKLASAVKRADIKKFEETLESNKDELMSQGLYFVAKRLSQNVIQEGIRKISV 284 > Hs20541815 Length=312 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Query 13 LHAFAAVLQQHELRFKLDDTFTLLRRLH-----QNVIRAG 47 L +F+ L++HEL L D T L+R QNV RAG Sbjct 78 LTSFSGKLREHELNSLLFDVHTTLKRHQSKTKSQNVFRAG 117 > At2g19560 Length=244 Score = 28.5 bits (62), Expect = 3.0, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 1 YREIVLPVRSGDLHAFAAVLQQHELRFKLDDTFTLLRRLHQNV 43 Y +IV +R GDL LQ+HE RF + +L +L V Sbjct 194 YTKIVQALRKGDLRLLRHALQEHEDRFLRSGVYLVLEKLELQV 236 Lambda K H 0.333 0.146 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1203243282 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40